Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate WP_013449840.1 SULKU_RS12970 phenylacetaldehyde dehydrogenase
Query= BRENDA::P25553 (479 letters) >NCBI__GCF_000183725.1:WP_013449840.1 Length = 481 Score = 273 bits (697), Expect = 1e-77 Identities = 161/472 (34%), Positives = 254/472 (53%), Gaps = 7/472 (1%) Query: 10 YIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERA 69 +I+GQ ID VNPAT V +++ AED +AI A A W E+ Sbjct: 7 FINGQNKPSHPGKVIDDVNPATGEVFAKVHLASAEDIEEAISTAYAASKLWAKTTPREKE 66 Query: 70 SWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS 129 + L K + R EI +++ E G + A E+ AD + A ARR G+ S Sbjct: 67 AVLLKAADIFESRTDEIRTILMRESGSVYAKAMFEIGLVADILRVAAGEARRVFGQTFTS 126 Query: 130 DRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFA 189 + PG +R LGV GI P+N P L +K A A+ GN V+KPS TP + F Sbjct: 127 NDPGVLSYSTRRPLGVIAGISPFNAPMILSTKKFAMAIAAGNAFVLKPSSHTPICGLIFG 186 Query: 190 KIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVC 249 +I E GLP GV N++ +G+ +P++AM+++TGS G+ + A+AA ++ K Sbjct: 187 EIFKEAGLPDGVLNIIPCSSGDLGETFQTDPRIAMITLTGSTRVGKLVAASAAMHLKKCT 246 Query: 250 LELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAM 309 +ELGGK+P IV+ DAD++ AV S ++ GQ+C R+ V++ IYD+F + + Sbjct: 247 VELGGKSPTIVLGDADVDYAVDTATFSIFLHQGQICMAGSRIIVEENIYDEFCEKFAAKV 306 Query: 310 QAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYYYPPTL 369 + ++ GNP + + I +GPLI A ++ + AV +GA + G E +G +Y PT+ Sbjct: 307 KTLKVGNPEDPSTI-IGPLIEEAQCRFIDGLIDDAVAKGATLLSGR---EHEGCFYKPTV 362 Query: 370 LLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKG 429 + +V +EM I HEE FGP ++ L+ I +AN+S+YGL+SSI T NL+ A++ + Sbjct: 363 VSNVTEEMVIFHEEAFGPAAAIIKARDLDHVIELANNSNYGLSSSIITDNLSAALRLSEE 422 Query: 430 LKFGETYINRENF--EAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS 479 ++ G +IN EA F G ++SG+G G + E + + V +++ Sbjct: 423 IESGMVHINGPTIQDEAHIPF-GGVKESGMGREGGHFAIEEMTELKWVTVEA 473 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 481 Length adjustment: 34 Effective length of query: 445 Effective length of database: 447 Effective search space: 198915 Effective search space used: 198915 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory