Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_013450178.1 CALNI_RS00220 DUF2437 domain-containing protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000183405.1:WP_013450178.1 Length = 251 Score = 110 bits (276), Expect = 3e-29 Identities = 71/223 (31%), Positives = 116/223 (52%), Gaps = 20/223 (8%) Query: 69 LSPLAPTDVPAIRGMGLQYSGDPANPQDKPPVACLFFKASQALAGPGDDIVLPRLARDEK 128 L P+ P+ V + +++ + N + P+ +F K S A+ G D I+ P +R+ Sbjct: 48 LPPVLPSKVVCVGRNYAEHAKELGNEVPEEPL--IFLKPSTAIIGTEDCIIYPSTSREVH 105 Query: 129 NDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGLCAKGGQWGMGKSYDTWCPF 188 +E EL VV+GK K V A ++ G+ VNDV++R + K ++ KS+DT+CP Sbjct: 106 --FEAELGVVIGKKCKAVTPDQAKDYILGFTCVNDVTARDIQKKENKFTRAKSFDTFCPI 163 Query: 189 GPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVLKIPELIARLSHGTTLQAGSLIL 248 GP + + +P + + + +NG++ Q GNT D++ + +LI+ +S+ TL G LI Sbjct: 164 GPVIQTE----LNPLSVQVISRLNGEIKQNGNTKDMIHNVYQLISFISNVMTLLPGDLIA 219 Query: 249 TGSPIALGRKAPGDAVEQSPFMKDGDEIRCFVEGCGTLINSVR 291 TG+P +G M GD I VEG G L N V+ Sbjct: 220 TGTPSGVGP------------MNVGDTIEVEVEGIGILRNYVK 250 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 251 Length adjustment: 25 Effective length of query: 283 Effective length of database: 226 Effective search space: 63958 Effective search space used: 63958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory