Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate WP_013450664.1 CALNI_RS02695 C4-dicarboxylate ABC transporter substrate-binding protein
Query= reanno::psRCH2:GFF85 (317 letters) >NCBI__GCF_000183405.1:WP_013450664.1 Length = 324 Score = 163 bits (413), Expect = 5e-45 Identities = 109/329 (33%), Positives = 171/329 (51%), Gaps = 19/329 (5%) Query: 3 LTKRLGLLAAAAAFTASTAAVAAPTFINILTGGTSGVYYPIGVALSQ-------QYNKID 55 + K L +L A + + + A TF+ I TGG +GVYYP+G A+++ QYN Sbjct: 1 MKKILVMLMAFSVIFSGSIFAAKQTFVTIGTGGVTGVYYPVGGAIARLVNAKKAQYN--- 57 Query: 56 GAKTSVQATKASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTY 115 K +V++T SV N+N + +G E + D A++G K K+L + G + Sbjct: 58 -IKATVESTGGSVYNINSVLSGDLEFGIAQADLTYQAYHGQGAWKDKGAQKKLAVVFGLH 116 Query: 116 NNYIQIVASAESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPY 175 N ++ +VASA SGI + DLKGKR+++G SG N+R + KA GL D+ + E++ Sbjct: 117 NEFVTLVASANSGINGIPDLKGKRVNLGGVGSGQLENSRDLLKAFGLKESDL-KAEYIKP 175 Query: 176 AESVELIKNRQLDATLQSSGLGMAAIRDLAS-TMPVTFVEIPAEVVEKI--ESDAYLAGV 232 ES LI++ +LDA + G ++ + S + V V I VEK+ E Y G Sbjct: 176 VESAGLIQDERLDAFFYTVGHPNGSVSEATSGRIKVKIVPITGTPVEKLIKELPYYSKGY 235 Query: 233 IPAGTY----DGQDADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKD 288 IP Y + +D VP++ I +LVT V +V Y +TK + +N+ H A Sbjct: 236 IPVSLYPNAANAKDGKVPSIGIQALLVTSTDVPADVVYAITKEVVENIQEFKKLHPALGG 295 Query: 289 IKLENATKNLPIPLHPGAERFYKEAGVLK 317 + +E+ PLHPGA +++KE G+ K Sbjct: 296 LDIEDMVNVNVAPLHPGALKYFKEKGLKK 324 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 324 Length adjustment: 28 Effective length of query: 289 Effective length of database: 296 Effective search space: 85544 Effective search space used: 85544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory