Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate WP_013450889.1 CALNI_RS03820 acetate kinase
Query= BRENDA::Q9WYB1 (403 letters) >NCBI__GCF_000183405.1:WP_013450889.1 Length = 415 Score = 456 bits (1173), Expect = e-133 Identities = 235/400 (58%), Positives = 294/400 (73%), Gaps = 3/400 (0%) Query: 1 MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRV-GDEKHVIERELPDH 59 M++L +N GSSS+KYQL + E +KV+ KGI ERIGI S +VH V G E H E E DH Sbjct: 1 MKILALNCGSSSVKYQLYDWENQKVVAKGIVERIGIGDSFIVHEVPGKETHREEYECHDH 60 Query: 60 EEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLA 119 A+ L+++TL GVI + EI AVGHRVVHGGE+FK SVL+ ++V+KAIEEV LA Sbjct: 61 ITAINLVVHTLESPTKGVISKISEISAVGHRVVHGGEKFKRSVLITDDVVKAIEEVQHLA 120 Query: 120 PLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRRYGFH 179 PLHNP NL GI+ A K+LP VP+VA+FDTAFHQT+P+ AYLYA+PYE+YEKY +RRYGFH Sbjct: 121 PLHNPPNLAGIRGAQKVLPDVPHVAIFDTAFHQTMPEYAYLYAVPYEWYEKYGVRRYGFH 180 Query: 180 GTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGT 239 GTSH YVSKRAA +LGK +E IIT HIGNG S A+K G VDTSMG TPLEG VMGT Sbjct: 181 GTSHLYVSKRAAALLGKPAKECNIITMHIGNGVSHTAIKNGVSVDTSMGLTPLEGAVMGT 240 Query: 240 RSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGDEWCK 299 R GDLDPA+P F+ ++ ++P+EM +ILNKKSG+ G++ G +D RD+ +GD+ C Sbjct: 241 RCGDLDPAVPLFMQQQLNVTPKEMDNILNKKSGILGIT-GKYTDRRDVIAGGEQGDKRCH 299 Query: 300 LVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKN 359 L LEI YR+ KYIGAY A + VDAIVFTAGVGEN+ + RE LE LG+ +D +KN Sbjct: 300 LALEIEAYRLKKYIGAYYAVLGRVDAIVFTAGVGENAWLIREKALQGLENLGIIIDFEKN 359 Query: 360 EETI-RGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIV 398 ++T + E ISTP+SRVKV V+PTNEEL+ D I+ Sbjct: 360 KKTFSKSGETEISTPESRVKVFVIPTNEELVFIEDVVAIL 399 Lambda K H 0.318 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 415 Length adjustment: 31 Effective length of query: 372 Effective length of database: 384 Effective search space: 142848 Effective search space used: 142848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_013450889.1 CALNI_RS03820 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.11038.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-163 527.9 0.1 8.5e-163 527.7 0.1 1.0 1 lcl|NCBI__GCF_000183405.1:WP_013450889.1 CALNI_RS03820 acetate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183405.1:WP_013450889.1 CALNI_RS03820 acetate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 527.7 0.1 8.5e-163 8.5e-163 4 403 .. 1 398 [. 1 400 [. 0.98 Alignments for each domain: == domain 1 score: 527.7 bits; conditional E-value: 8.5e-163 TIGR00016 4 kkilvlnaGssslkfalldaensekvllsglverikleeariktvedgekkeeeklaiedheeavkkll 72 +kil ln+Gsss+k++l+d en +kv+++g+veri + +++i + g+++++e+ + +dh +a++ ++ lcl|NCBI__GCF_000183405.1:WP_013450889.1 1 MKILALNCGSSSVKYQLYDWEN-QKVVAKGIVERIGIGDSFIVHEVPGKETHREEYECHDHITAINLVV 68 69*******************7.7777****************************************** PP TIGR00016 73 ntlkk.dkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavlkl 140 +tl++ k ++ + sei+++GHRvvhGgekf+ sv++td+v+k+i+++ +lAPlHnp++l gi+ ++ lcl|NCBI__GCF_000183405.1:WP_013450889.1 69 HTLESpTKGVISKISEISAVGHRVVHGGEKFKRSVLITDDVVKAIEEVQHLAPLHNPPNLAGIRGAQ-- 135 *****9999**********************************************************.. PP TIGR00016 141 kvllkaknvavFDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddlnl 209 kvl+++++va+FDtafHqt+pe aylYa+Py++y+++gvRrYGfHGtsh yv++raa ll+kp+++ n+ lcl|NCBI__GCF_000183405.1:WP_013450889.1 136 KVLPDVPHVAIFDTAFHQTMPEYAYLYAVPYEWYEKYGVRRYGFHGTSHLYVSKRAAALLGKPAKECNI 204 99******************************************************************* PP TIGR00016 210 ivcHlGnGasvsavknGksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkksG 278 i++H+GnG s +a+knG s+dtsmGltPLeG vmGtR+Gd+Dpa+ +++++l+ + +e+ ++lnkksG lcl|NCBI__GCF_000183405.1:WP_013450889.1 205 ITMHIGNGVSHTAIKNGVSVDTSMGLTPLEGAVMGTRCGDLDPAVPLFMQQQLNVTPKEMDNILNKKSG 273 ********************************************************************* PP TIGR00016 279 llgisglssDlRdildkkeegneeaklAlkvyvhRiakyigkyiaslegelDaivFtgGiGenaaevre 347 +lgi+g+ +D Rd+++ e+g+++++lAl++ ++R++kyig+y a l g++DaivFt+G+Gena +re lcl|NCBI__GCF_000183405.1:WP_013450889.1 274 ILGITGKYTDRRDVIAGGEQGDKRCHLALEIEAYRLKKYIGAYYAVL-GRVDAIVFTAGVGENAWLIRE 341 ***********************************************.67******************* PP TIGR00016 348 lvleklevlGlkldlelnnaa.rsgkesvisteeskvkvlviptneelviaeDalrl 403 ++l++le lG+ +d e+n+++ ++ e+ ist+es+vkv+viptneelv +eD++ + lcl|NCBI__GCF_000183405.1:WP_013450889.1 342 KALQGLENLGIIIDFEKNKKTfSKSGETEISTPESRVKVFVIPTNEELVFIEDVVAI 398 *******************9988999***************************9865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (415 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.57 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory