Align phosphotransacetylase (EC 2.3.1.8) (characterized)
to candidate WP_013450890.1 CALNI_RS03825 phosphate acetyltransferase
Query= metacyc::PTACLOS-MONOMER (333 letters) >NCBI__GCF_000183405.1:WP_013450890.1 Length = 328 Score = 320 bits (820), Expect = 3e-92 Identities = 165/329 (50%), Positives = 222/329 (67%), Gaps = 1/329 (0%) Query: 1 MDLIESIWECAKQDKKRIILAEGEEKRNLIAADKIIKEGLAELVLVGDENKIKEKASELN 60 M L+E WE AKQ +K I+L EG ++R + AA I++ LA+++++GDE KI+ Sbjct: 1 MPLMEKFWEMAKQRQKTIVLPEGHDERTIDAAHTIVQNKLAKIIVLGDEQKIESLFKAKG 60 Query: 61 LDISKAEIMDPETSLKTETYARDFYELRKHKGMTIEKSEKMVRDPLYFATMALKDGYVDG 120 IS EI++P TS +A +Y RK KG++ E++ ++D LYF M ++ G Sbjct: 61 YPIS-CEIINPTTSKYLNDFASAYYNKRKSKGISEEEALNCMKDILYFGAMLVEQDIAQG 119 Query: 121 MVSGAVHTTGDLLRPGLQIIKTAPGVKIVSGFFVMIIPDCDYGEEGLLLFADCAVNPNPT 180 V+GA +TT D+LR +++I T PG+ VS F+M+ ++G++G +LFADCAVNPNP Sbjct: 120 CVTGACNTTADVLRAAIRVIGTKPGINTVSSCFIMVTNKKEFGKDGAILFADCAVNPNPD 179 Query: 181 SDELADIAITTAETARKLCNVEPKVAMLSFSTMGSAKGEMVDKVKNAVEITKKFRPDLAI 240 S +LA+IA+ TA++ R EP+VAMLSFST GSA+ +DKV A++I K+ PDL I Sbjct: 180 SRQLAEIAVATADSCRAFLEEEPRVAMLSFSTKGSAQHPDIDKVLEALKIAKEISPDLMI 239 Query: 241 DGELQLDAAIDSEVAALKAPSSNVAGNANVLVFPDLQTGNIGYKLVQRFAKAKAIGPICQ 300 DGE+Q DAA+ V KAP SNVAG ANVL+FPDL GNI YKLV+R A A+AIGPI Q Sbjct: 240 DGEMQADAALIKAVGEKKAPGSNVAGKANVLIFPDLDAGNIAYKLVERIAGAEAIGPIIQ 299 Query: 301 GFAKPINDLSRGCSSEDIVNVVAITVVQA 329 G KP+NDLSRGC DIVNV AIT VQA Sbjct: 300 GLRKPVNDLSRGCKYMDIVNVAAITAVQA 328 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 328 Length adjustment: 28 Effective length of query: 305 Effective length of database: 300 Effective search space: 91500 Effective search space used: 91500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_013450890.1 CALNI_RS03825 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.28933.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-123 398.0 1.1 1.8e-123 397.8 1.1 1.0 1 lcl|NCBI__GCF_000183405.1:WP_013450890.1 CALNI_RS03825 phosphate acetyltr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183405.1:WP_013450890.1 CALNI_RS03825 phosphate acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.8 1.1 1.8e-123 1.8e-123 1 304 [] 18 325 .. 18 325 .. 0.97 Alignments for each domain: == domain 1 score: 397.8 bits; conditional E-value: 1.8e-123 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverly 69 ivlPEg++er+++Aa++++++k+a+ ++l++++++++ +k + ++++++p++sk +++++ ++y lcl|NCBI__GCF_000183405.1:WP_013450890.1 18 IVLPEGHDERTIDAAHTIVQNKLAKIIVLGDEQKIES-LFKAKGYPI-SCEIINPTTSKYLNDFASAYY 84 8******************************999999.444444444.56788999999********** PP TIGR00651 70 ekrkhkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfi 138 +krk kG++e+ea + ++D ++++a+lve++ a+g+v+Ga +tta++lr+a+++i+t++g+++vss+fi lcl|NCBI__GCF_000183405.1:WP_013450890.1 85 NKRKSKGISEEEALNCMKDILYFGAMLVEQDIAQGCVTGACNTTADVLRAAIRVIGTKPGINTVSSCFI 153 ********************************************************************* PP TIGR00651 139 mekee......evlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevek 201 m +++ + ++faDCav+++P++++LAeiA+ +a+s++++ eeep+va+ls+stkgs++ +++k lcl|NCBI__GCF_000183405.1:WP_013450890.1 154 MVTNKkefgkdGAILFADCAVNPNPDSRQLAEIAVATADSCRAFLEEEPRVAMLSFSTKGSAQHPDIDK 222 ***99999999999******************************************************* PP TIGR00651 202 vkeAvkilkekepdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRlada 270 v eA+ki+ke pdl++dGe+q DaAl++ v ekkap s+vagkanv++FPdLdaGni+Yk+v+R+a+a lcl|NCBI__GCF_000183405.1:WP_013450890.1 223 VLEALKIAKEISPDLMIDGEMQADAALIKAVGEKKAPGSNVAGKANVLIFPDLDAGNIAYKLVERIAGA 291 ********************************************************************* PP TIGR00651 271 eaiGPilqGlakPvnDLsRGasvedivnvviita 304 eaiGPi+qGl+kPvnDLsRG++ divnv++ita lcl|NCBI__GCF_000183405.1:WP_013450890.1 292 EAIGPIIQGLRKPVNDLSRGCKYMDIVNVAAITA 325 ********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (328 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.00 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory