Align branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized)
to candidate WP_013451017.1 CALNI_RS04470 branched-chain amino acid ABC transporter permease
Query= ecocyc::LIVH-MONOMER (308 letters) >NCBI__GCF_000183405.1:WP_013451017.1 Length = 287 Score = 167 bits (424), Expect = 2e-46 Identities = 95/300 (31%), Positives = 166/300 (55%), Gaps = 13/300 (4%) Query: 9 LQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAALMMMGIDT 68 +Q +++G+T GS YAL+AIGY ++Y G+INFA GE ++G + + L M G++ Sbjct: 1 MQFLYSGITSGSIYALVAIGYNIIYNTTGLINFAQGEFVVLGGMLMY---TTLTMFGVNL 57 Query: 69 GWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQNYVSLTEGS 128 + F+ ++ G ERV R VR + + I ++I L+ + G Sbjct: 58 FY-----AFLITFILMFFVGILFERVFLRYVRLKTEINLITVTIALAIILRGIAMVIWGR 112 Query: 129 RDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACRACA 188 +A+PS + V+ SIT+ V+ +V F + L+ F +Y++ G+A RAC Sbjct: 113 DSLAVPSYVEEKTVM----LAGGSITSQSMVVIVVCFFTAIVLSTFFKYTKYGKAFRACH 168 Query: 189 EDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGMKAFTAAVL 248 +D +++ GI+ + + L+F I + + A+AG ++ V G M+G+K F+AA+L Sbjct: 169 DDQVASTICGIDVNLIRMLSFAIASLLGALAGAIIAPITFVTYTD-GVMSGLKGFSAAIL 227 Query: 249 GGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGILGRPEVEKV 308 GG+GS G + GG +LGI EA + L + +KD +F +L+L+L + P+G+ G+ + +V Sbjct: 228 GGMGSFWGGLFGGFLLGIIEAFFAFILPSGFKDAFAFIILLLILFIKPSGLFGKKKAVRV 287 Lambda K H 0.328 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 287 Length adjustment: 26 Effective length of query: 282 Effective length of database: 261 Effective search space: 73602 Effective search space used: 73602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory