Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_013451345.1 CALNI_RS06140 3-oxoacyl-[acyl-carrier-protein] reductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000183405.1:WP_013451345.1 Length = 247 Score = 103 bits (257), Expect = 3e-27 Identities = 75/250 (30%), Positives = 122/250 (48%), Gaps = 17/250 (6%) Query: 15 VLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAV-FRDKYPGTVAT----RADVSDA 69 VL++G + GIG +A + E+GA+V + S AV +++ T +++++D Sbjct: 7 VLVTGASRGIGRAIAKDFAESGAKVCINYSSSKEKAVELKEEIISKGFTAEIFQSNIADE 66 Query: 70 AQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAV 129 + ++A+F + G +D+LVNNAGI I + EW IN NL + A Sbjct: 67 SSVKAMFDEIEKTFGVVDILVNNAGIT-KDNIILRMKSEEWDDVINTNLKGAFNCIKIAS 125 Query: 130 PMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPG 189 + + +G +++I SV G + Y ++K IVGL KS A EL IRVNA+ PG Sbjct: 126 KGMMKKRYGKIINITSVVAFTGNVGQANYISSKSGIVGLTKSAAIELAGRGIRVNAIAPG 185 Query: 190 IVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVT 249 +E E +++ L++I L EDV+ LFL SP + +T Sbjct: 186 FIE-----------TEMTKDLPEDVKNGMLSRILLGYFGKPEDVSKACLFLASPDSDYIT 234 Query: 250 GQAISVDGNV 259 G + V+G + Sbjct: 235 GSVLHVNGGM 244 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 247 Length adjustment: 24 Effective length of query: 238 Effective length of database: 223 Effective search space: 53074 Effective search space used: 53074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory