GapMind for catabolism of small carbon sources

 

Alignments for a candidate for dctQ in Calditerrivibrio nitroreducens DSM 19672

Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized)
to candidate WP_013451823.1 CALNI_RS08605 TRAP transporter small permease

Query= SwissProt::O07837
         (227 letters)



>NCBI__GCF_000183405.1:WP_013451823.1
          Length = 173

 Score = 82.4 bits (202), Expect = 5e-21
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 30/169 (17%)

Query: 5   LDRAEEVLIAALIATATVLIFVSVTHRFTLGFVADFVGFFRGHGMTGAAAAAKSLYTTLR 64
           LD+    +++ ++A ATV+ F++V  R+         GF                     
Sbjct: 12  LDKINIFIMSVMMAVATVVAFINVVLRY---------GF--------------------- 41

Query: 65  GINLVWAQELCIILFVWMAKFGAAYGVRTGIHVGIDVLINRLDAPKRRFFILLGLGAGAL 124
            ++L WA EL   LF+W   FG AYG +TG+H+G+  LI RL++   +  +   L    +
Sbjct: 42  NMSLTWAGELTSYLFIWSVLFGTAYGFKTGLHLGVTFLIQRLNSNMAKKLLTFSLFVVFV 101

Query: 125 FTGIIATLGANFVLHMYHASSTSPDLELPMWLVYLAIPMGSSLMCFRFL 173
           F  ++   G +FV   Y     S DL +  W++YL +P+  ++  ++ L
Sbjct: 102 FLLVLIKWGYDFVKFNYELEQVSVDLHIKFWIIYLCVPITMAISAYQIL 150


Lambda     K      H
   0.328    0.143    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 84
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 227
Length of database: 173
Length adjustment: 20
Effective length of query: 207
Effective length of database: 153
Effective search space:    31671
Effective search space used:    31671
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory