GapMind for catabolism of small carbon sources

 

Protein WP_013451930.1 in Calditerrivibrio nitroreducens DSM 19672

Annotation: NCBI__GCF_000183405.1:WP_013451930.1

Length: 247 amino acids

Source: GCF_000183405.1 in NCBI

Candidate for 83 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gltL med GluA aka CGL1950, component of Glutamate porter (characterized) 62% 99% 293.9 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-asparagine catabolism bgtA med ATPase (characterized, see rationale) 61% 93% 292.4 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-aspartate catabolism bgtA med ATPase (characterized, see rationale) 61% 93% 292.4 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-alanine catabolism Pf6N2E2_5405 med ABC transporter for D-Alanine, ATPase component (characterized) 60% 96% 290 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 58% 94% 287 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 58% 94% 285.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 58% 94% 285.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 58% 94% 283.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 58% 94% 283.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 58% 94% 283.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 58% 94% 283.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 58% 94% 283.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 61% 100% 280.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 58% 98% 280 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-asparagine catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 58% 100% 270.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-aspartate catabolism aatP med Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 58% 100% 270.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-histidine catabolism bgtA med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 55% 96% 266.2 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-lysine catabolism hisP med BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 55% 96% 266.2 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 56% 99% 256.9 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 56% 99% 256.9 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-glucosamine, ATPase component (characterized) 53% 94% 254.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 51% 95% 254.2 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-histidine catabolism hisP med Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 50% 99% 251.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-citrulline catabolism AO353_03040 med ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 53% 98% 245 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-citrulline catabolism PS417_17605 med ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 50% 92% 238.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-histidine catabolism PA5503 med Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 41% 72% 179.9 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 42% 73% 170.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 41% 56% 168.7 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 37% 62% 165.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 63% 164.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 39% 63% 163.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 38% 63% 161.4 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 38% 63% 161.4 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 63% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 63% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 39% 69% 158.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 40% 65% 157.9 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 81% 157.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 81% 157.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 38% 67% 156.4 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 38% 69% 156 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 37% 63% 153.7 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism thuK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 63% 153.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-cellobiose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-glucose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
lactose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
sucrose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 61% 152.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 38% 62% 152.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 36% 64% 150.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 38% 61% 150.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 33% 62% 149.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 63% 149.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 34% 73% 144.8 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 38% 57% 143.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 38% 84% 141.7 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 65% 141 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 33% 76% 141 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 65% 141 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 58% 139.4 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 38% 77% 135.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 61% 135.2 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 33% 62% 133.3 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 34% 79% 132.1 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 36% 69% 122.5 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 34% 58% 108.6 Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.- 63% 303.1

Sequence Analysis Tools

View WP_013451930.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MISGNVIIKAENVVKVYHNGVRALKGVSLDIYQGEVVVIIGPSGSGKSTFLRTLNHLETI
NEGKITIDGIELTHNKTNINKIREEVGMVFQQFNLFPHLTAMENITLAPRVVKKMSKEEA
EEIAQKLLDRVGLGDRGGSYPSQLSGGQQQRVAIARALAMKPKIMLFDEPTSALDPEMIG
EVLDVMKTLAKDGMTMVVVTHEMGFAREVSDRIVFMDEGNIVEMGKPEEIFSNPKNERLK
QFLGQIL

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory