Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_013451938.1 CALNI_RS09200 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000183405.1:WP_013451938.1 Length = 350 Score = 172 bits (435), Expect = 1e-47 Identities = 104/298 (34%), Positives = 161/298 (54%), Gaps = 29/298 (9%) Query: 32 NLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGA-F 90 N + + IL I I+ I AVGLN++ GF+G SLGH F+ +GA+A G + YG F Sbjct: 44 NSYILYILNMIFISSIAAVGLNILTGFTGLISLGHGAFIGVGAFAT---GYLAMNYGMNF 100 Query: 91 FGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAG--- 147 + A+ + AL + + ++ G+P+LRLK YL++ATL I+ I S T G G Sbjct: 101 YFAIPLAALFTAIIGIIFGLPSLRLKDLYLSIATLAAQFILEFIFIRAESFTGGVNGMPV 160 Query: 148 ----ILGIP---NFTTWQMVYFFVVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNT 200 I GI +F + Y F +I N LR+ IGR+ +SVR++ IAAE++GV+ Sbjct: 161 ASPTIFGIEINNDFRFYFFAYSFAIIMITVAKNILRTRIGRAFISVRDNYIAAEAMGVDV 220 Query: 201 TKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVS 260 K K+++F + A IAGSL A ++ + P+ +T SI L +++ GGLGS+ G+I Sbjct: 221 FKYKLLSFGISSFYAGIAGSLWAYYVQFITPEHFTITVSIQYLSMIIIGGLGSLLGSIFG 280 Query: 261 AIVLGILNMLLQDVA---------------SVRMIIYALALVLVMIFRPGGLLGTWEL 303 I + IL +L+ + ++R Y L ++L ++F P GL W L Sbjct: 281 TIFIVILPEILRHIVDLLSGAAPFLKQIFPAIREAFYGLVIILFLLFEPEGLARRWNL 338 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 350 Length adjustment: 28 Effective length of query: 290 Effective length of database: 322 Effective search space: 93380 Effective search space used: 93380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory