Align ABC transporter permease (characterized, see rationale)
to candidate WP_013451939.1 CALNI_RS09205 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KC95 (309 letters) >NCBI__GCF_000183405.1:WP_013451939.1 Length = 294 Score = 168 bits (425), Expect = 2e-46 Identities = 96/302 (31%), Positives = 164/302 (54%), Gaps = 15/302 (4%) Query: 1 MDILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGA 60 M+ L Q II G+V+GS+Y+L+ALG+T++Y ++NFA GE+L++GA + C+ + Sbjct: 1 MEFLTQIIIAGIVIGSIYSLVALGFTLIYKSTGIVNFAQGELLLVGA---YICLHLTVSY 57 Query: 61 MPGAPGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAM 120 + + + +I + F IE+V R + P ++ ++ IG+S LL+++ Sbjct: 58 Q------IPFIFSFLITLIFMFFFGFFIERVFLRRMIGEPIISIIMLTIGLSSLLKSIVQ 111 Query: 121 IIWKPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRAT 180 IIW + + +P + P +IG I+ I L A+ L Y T G AMRA Sbjct: 112 IIWGTDTRTFPEIFSHEPVKIGFLNISTVYIFALISIAIFLGIFSYFFKTTKTGVAMRAV 171 Query: 181 AENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAV 240 A + + A MG+ + + ++ I A+++ + G++ + G F GLK F + Sbjct: 172 ASDQQAALSMGIDVRKIFALSWAIAAIVSTVGGVLLGNINGINTSLSQF--GLKVFPVVI 229 Query: 241 FGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGL 300 GG+ ++ GA+VGGI++G++E I GYI L GG ++F F+ +IIIL ++P GL Sbjct: 230 LGGLDSIMGAIVGGIIIGVLENIVGGYIDPLLGG----GAKEVFPFVAMIIILLIKPYGL 285 Query: 301 LG 302 G Sbjct: 286 FG 287 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 294 Length adjustment: 27 Effective length of query: 282 Effective length of database: 267 Effective search space: 75294 Effective search space used: 75294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory