Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate WP_013452043.1 CALNI_RS09785 fructose-1,6-bisphosphate aldolase, class II
Query= BRENDA::O97447 (323 letters) >NCBI__GCF_000183405.1:WP_013452043.1 Length = 324 Score = 279 bits (714), Expect = 6e-80 Identities = 151/315 (47%), Positives = 204/315 (64%), Gaps = 10/315 (3%) Query: 3 LCTLRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKYSDMIYL 62 L R+M +A + KY V A+N NN+EQ+Q I++A V+ KSPVILQ S+GA +Y++ L Sbjct: 10 LVNTREMFKKAMEGKYAVPAYNFNNLEQLQAIIQACVETKSPVILQVSKGAREYANATIL 69 Query: 63 KKLC----EAALEKHPDIPICIHLDHGDTLESVKMAIDLGFSSVMIDASHHPFDENVRIT 118 + L + A E IPI +HLDHGD+ E K +D GFSSVMID SH PF+EN+ +T Sbjct: 70 RYLALGATQLAEEMGHKIPIALHLDHGDSFEICKSCVDYGFSSVMIDGSHLPFEENIAVT 129 Query: 119 KEVVAYAHARSVSVEAELGTLGGIEEDVQ-NTVQLTEPQDAKKFVELTGVDALAVAIGTS 177 ++VV YAH V+VE ELG L GIE+DV T+P ++FV TGVD+LA++IGTS Sbjct: 130 RKVVEYAHQFDVTVEGELGVLAGIEDDVSAEHSHYTDPAQVEEFVAKTGVDSLAISIGTS 189 Query: 178 HGAYKFK---SESDIRLAIDRVKTISD-LTGIPLVMHGSSSVPKDVKDMINKYGGKMPDA 233 HGAYKFK E L D ++ + L G P+V+HG+SSV + ++INKYGGK+ A Sbjct: 190 HGAYKFKVKPGEEVPPLRFDILEEVEKRLPGFPIVLHGASSVVPEYVELINKYGGKLEGA 249 Query: 234 VGVPIESIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHPEKFDPRDYLGPGRDAITEM 293 VGVP E + A VCKIN+DSD R+A T +R+ +P++FDPR YL P R+ + ++ Sbjct: 250 VGVPEEQLRRAAASAVCKINIDSDGRLAFTAKVREYLANNPKEFDPRKYLKPAREELVKL 309 Query: 294 LIPK-IKAFGSAGHA 307 K I GSAG A Sbjct: 310 YKHKNINVLGSAGKA 324 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 324 Length adjustment: 28 Effective length of query: 295 Effective length of database: 296 Effective search space: 87320 Effective search space used: 87320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_013452043.1 CALNI_RS09785 (fructose-1,6-bisphosphate aldolase, class II)
to HMM TIGR01859 (fba: fructose-1,6-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01859.hmm # target sequence database: /tmp/gapView.6551.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01859 [M=282] Accession: TIGR01859 Description: fruc_bis_ald_: fructose-1,6-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-118 379.6 0.1 7.3e-118 379.3 0.1 1.1 1 lcl|NCBI__GCF_000183405.1:WP_013452043.1 CALNI_RS09785 fructose-1,6-bisph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183405.1:WP_013452043.1 CALNI_RS09785 fructose-1,6-bisphosphate aldolase, class II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.3 0.1 7.3e-118 7.3e-118 1 282 [] 10 324 .] 10 324 .] 0.95 Alignments for each domain: == domain 1 score: 379.3 bits; conditional E-value: 7.3e-118 TIGR01859 1 lvkakellekakkekYavgafninnlellqaileaaeeeksPvivqvsegavkYlg..gikvvvalvka 67 lv+++e+++ka ++kYav+a+n+nnle+lqai++a+ e+ksPvi+qvs+ga++Y++ ++ ++ ++ lcl|NCBI__GCF_000183405.1:WP_013452043.1 10 LVNTREMFKKAMEGKYAVPAYNFNNLEQLQAIIQACVETKSPVILQVSKGAREYANatILRYLALGATQ 78 79******************************************************4333344444678 PP TIGR01859 68 lieklsi.vPvalhLDhGssyescikaikaGfssvmiDashlpleenlketkkvveiahakgvsveael 135 l+e++ + +P+alhLDhG+s+e c ++++ GfssvmiD+shlp+een++ t+kvve+ah+ v+ve el lcl|NCBI__GCF_000183405.1:WP_013452043.1 79 LAEEMGHkIPIALHLDHGDSFEICKSCVDYGFSSVMIDGSHLPFEENIAVTRKVVEYAHQFDVTVEGEL 147 99999999************************************************************* PP TIGR01859 136 GklgGieddvvekeaeladideakklvketgvDaLaiaiGtshGkykge.......pkldferlkeikk 197 G+l+Gieddv +++++++d+ +++++v +tgvD+Lai+iGtshG yk + p l+f+ l+e++k lcl|NCBI__GCF_000183405.1:WP_013452043.1 148 GVLAGIEDDVSAEHSHYTDPAQVEEFVAKTGVDSLAISIGTSHGAYKFKvkpgeevPPLRFDILEEVEK 216 ********************************************666555599999************* PP TIGR01859 198 lln.lPlvlhGas.....................Gipeeqlkkaiklgiakvnidtdlrlaftaairkv 244 +l+ +P+vlhGas G+peeql++a+ ++++k+nid+d rlafta++r++ lcl|NCBI__GCF_000183405.1:WP_013452043.1 217 RLPgFPIVLHGASsvvpeyvelinkyggklegavGVPEEQLRRAAASAVCKINIDSDGRLAFTAKVREY 285 **99***************************************************************** PP TIGR01859 245 leekkdeydpRkilaparealkevvkekik.vlgsagka 282 l+++ +e+dpRk+l+pare+l +++k+k+ vlgsagka lcl|NCBI__GCF_000183405.1:WP_013452043.1 286 LANNPKEFDPRKYLKPAREELVKLYKHKNInVLGSAGKA 324 ***************************9755******97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (282 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.23 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory