Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_013459011.1 SULKU_RS00765 short-chain dehydrogenase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_000183725.1:WP_013459011.1 Length = 228 Score = 66.2 bits (160), Expect = 6e-16 Identities = 57/184 (30%), Positives = 89/184 (48%), Gaps = 19/184 (10%) Query: 14 VTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDISSASEVHKTVDHI 73 VTG +SGIG AI LL G NV + GD H + P D+S + VD + Sbjct: 6 VTGTSSGIGEAIAQILLQNGYNVIGLSRRRGDIHHPL--FEHLPCDLSDLA----VVDIL 59 Query: 74 IQRFGRIDGL---VNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKGVFLMSQAV 130 ++ I+ L VN AG F R E EL+ M+++N L++ A+ Sbjct: 60 QKKLTEIEDLEILVNAAG--FGRFEPHE-------ELSSKTITDMISLNLTTPILLANAL 110 Query: 131 ARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHGIRVVGVAP 190 R + K+ G+I+N++S S+ + Y+ATKA L +F + +E G++VV + P Sbjct: 111 MRPL-KKTKGMIINITSIEATRHSKFSALYSATKAGLRAFGLTLFEETRNAGVKVVTINP 169 Query: 191 GILE 194 + E Sbjct: 170 DMTE 173 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 228 Length adjustment: 24 Effective length of query: 243 Effective length of database: 204 Effective search space: 49572 Effective search space used: 49572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory