Align Δ1-piperideine-6-carboxylate dehydrogenase (characterized)
to candidate WP_013459096.1 SULKU_RS01190 aldehyde dehydrogenase
Query= metacyc::MONOMER-12387 (496 letters) >NCBI__GCF_000183725.1:WP_013459096.1 Length = 471 Score = 142 bits (357), Expect = 3e-38 Identities = 115/374 (30%), Positives = 168/374 (44%), Gaps = 20/374 (5%) Query: 54 EDVDRAVEAAHTAFLTWRTTPAPVRGALVKRFGELLTEHKQDLADLVTIEAGKIRSEALG 113 +D +A+ A A + R A + L E +++ A ++ E GK + A Sbjct: 38 DDARQALIIAQNASKIAKKVALHQRCAWLLDVASKLKEQREEFARVLCDEVGKPITYARI 97 Query: 114 EVQEMIDICDFAVGLSRQLYGRT-----MPSERPGHRLMETWHPLGVVGVISAFNFPVAV 168 EV I+ + R ++G + MPS R H GVV I+ FNFP+ + Sbjct: 98 EVDRCIETITLSAETMRTMHGESINTDAMPSGRAAHAYWRR-EAAGVVVAITPFNFPLNL 156 Query: 169 WAWNAAVALVCGDTVVWKPSELTPLNRAACA-ALLDLAIADAGAPKGLNQVVVGAADVGE 227 A A ALV G+ VV KP+ PL CA L L I A VV G A+VG Sbjct: 157 VAHKLAPALVAGNAVVLKPTPEAPL----CAYKLAQLFIESPYATPDALSVVYGDAEVGS 212 Query: 228 RLVDSPRVPLVSATGSTRMGRAVGPRVAARFGRTILELGGNNAAVVTPSADLDLTVNAAV 287 LV S ++S TGS +G + +A + LELGGN A + SADL+ Sbjct: 213 ALVGSDIPRVISFTGSVGVGNIITR--SAGIKKISLELGGNAATYIDTSADLEYAAARCA 270 Query: 288 FAAAGTAGQRCTTLRRLIVHEDIADTVVERLTAAFERLPIGDPFQDTTLVGPLVNEAAFG 347 A +GQ C +L+R+ V + D ++ A +L +G P+ D T +GPL+N+ A Sbjct: 271 IGAFVNSGQVCISLQRIYVDSSVYDEFALKMAEATSKLVVGSPYNDDTFLGPLINDEAAS 330 Query: 348 RMREAVERATAEGGTLCAGGERQFPDAAPGAYYVRPALVRMPAQTAVVREETFAPILYVL 407 R VE A EG P G + + + +V EE FAPI+ ++ Sbjct: 331 RAMSWVESAIEEGARALT------PPRCEGRIFYPCVMADVTESMKIVCEEVFAPIVSLV 384 Query: 408 TYRDLDEAI-RLNN 420 +D+AI R+NN Sbjct: 385 RVDGIDDAITRMNN 398 Lambda K H 0.320 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 496 Length of database: 471 Length adjustment: 34 Effective length of query: 462 Effective length of database: 437 Effective search space: 201894 Effective search space used: 201894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory