Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_013459153.1 SULKU_RS01480 triose-phosphate isomerase
Query= BRENDA::P56076 (234 letters) >NCBI__GCF_000183725.1:WP_013459153.1 Length = 239 Score = 186 bits (472), Expect = 3e-52 Identities = 105/232 (45%), Positives = 143/232 (61%), Gaps = 8/232 (3%) Query: 4 IAMANFKSAMPIFKSHAYLKELEKTLKPQHF-DRVFVFPDFFGLL--PNSFLHFTLGVQN 60 I ANFK+ ++ AY+ +E + D + VFP F L P + L +GVQN Sbjct: 2 ILCANFKANKTRQETRAYMAVVESFVSANDITDTIIVFPPFTALEHDPRNVL---IGVQN 58 Query: 61 AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRTLLKESPSFLKEKFDFFKSKNFKIVY 120 YP GAFTGEI + LEE I T+LIGHSERR +L E+ + KF FF + F IVY Sbjct: 59 GYPVKNGAFTGEIALEQLEEFGIKTILIGHSERRHILGETQEQIAAKFRFFAEQGFLIVY 118 Query: 121 CIGEELTTREKGFKAVKEFLSEQLENIDLNYPNLVVAYEPIWAIGTKKSASLEDIYLTHG 180 C+GE L RE+G +A+ ++ +Q E IDL Y +LV+AYEP+WAIGT + S DI L HG Sbjct: 119 CVGEPLEIREQGHEALMAYIEKQFEGIDLTYSDLVLAYEPVWAIGTGLTPSNSDIELLHG 178 Query: 181 FLKQILNQKTPLLYGGSVNTQNAKEILGIDSVDGLLIGSASWELENFKTIIS 232 L+ + PLLYGGSV NA EI+ +++VDG+L+GSA+ +F +I+ Sbjct: 179 ALR--MKTTAPLLYGGSVKVDNAGEIMALENVDGVLVGSAALSANDFCDMIA 228 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 234 Length of database: 239 Length adjustment: 23 Effective length of query: 211 Effective length of database: 216 Effective search space: 45576 Effective search space used: 45576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory