Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate WP_013459847.1 SULKU_RS04995 3-isopropylmalate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >NCBI__GCF_000183725.1:WP_013459847.1 Length = 358 Score = 220 bits (560), Expect = 5e-62 Identities = 142/335 (42%), Positives = 200/335 (59%), Gaps = 24/335 (7%) Query: 2 AYRICLIEGDGIGHEVIPAARRVLEATG----LPLEFVEAEAGWETFERRGTSVPEETVE 57 +Y I LI+GDGIG E+I A +VL+A + + EA G ++ G +P+ET++ Sbjct: 3 SYNIALIKGDGIGPEIIDEAVKVLDAVAACENIEFNYQEALMGGCAYDVTGDPLPQETID 62 Query: 58 KILSCHATLFGAA------TSPTRKVPGFFGAIRYLRRRLDLYANVRPAK--------SR 103 LS +A LFGA T P K P G +R+ R+ L ++AN+RPA S Sbjct: 63 ISLSSNAVLFGAIGGQKWDTLPREKRPES-GLLRF-RKELGVFANLRPANVYDELVNASS 120 Query: 104 PVPGSRPGVDLVIVRENTEGLYV-EQERRYLDVAIADAVISKKASERIGRAALRIAEGRP 162 P GVDL++VRE G+Y E + R + V ++ ERI A +IA R Sbjct: 121 LKPEIVKGVDLMVVRELIGGIYFGEPKGRDENKGWNTMVYTRPEIERIAHVAFKIAMERS 180 Query: 163 RKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVT 222 +K + KANVL ++Q L+ + V+EVAK++P V + + VDN AMQL+ P++FDVI+T Sbjct: 181 KKVCSV-DKANVLDVSQ-LWREVVEEVAKEYPEVELSHMYVDNAAMQLIRDPKQFDVILT 238 Query: 223 TNLLGDILSDLAAGLVGGLGLAPSGNIGDTTAVFEPVHGSAPDIAGKGIANPTAAILSAA 282 N+ GDILSD A+ L G +GL PS ++G + V+EP+HGSAPDIAG+GIANP A I SA+ Sbjct: 239 GNIFGDILSDEASMLSGSIGLLPSASVGSSIGVYEPIHGSAPDIAGQGIANPIATIASAS 298 Query: 283 MMLDY-LGEKEAAKRVEKAVDLVLERGPRTPDLGG 316 MML + LGE AA R++ + L G RT D+ G Sbjct: 299 MMLRFALGENRAADRIDYGIKQALAEGYRTKDIAG 333 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 358 Length adjustment: 29 Effective length of query: 305 Effective length of database: 329 Effective search space: 100345 Effective search space used: 100345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory