Align alpha-ketoglutarate permease (MHS family) (characterized)
to candidate WP_013518722.1 ALIDE2_RS10370 MFS transporter
Query= reanno::pseudo5_N2C3_1:AO356_17790 (439 letters) >NCBI__GCF_000204645.1:WP_013518722.1 Length = 446 Score = 233 bits (594), Expect = 9e-66 Identities = 137/393 (34%), Positives = 225/393 (57%), Gaps = 12/393 (3%) Query: 34 GNMVEWYDWYVYAAFSLYFAKVFFPKGDTTAQLLNTAAIFAVGFLMRPIGGWLMGLYADR 93 GN +E++D+ YA F++Y + FFP + ++ + A+F VGF+ RP+GG L+G +ADR Sbjct: 42 GNALEFFDFTTYAFFAVYIGQTFFPADEPLVTVMLSVAVFGVGFITRPLGGLLIGAFADR 101 Query: 94 AGRKRALMASVYLMCFGSLIIALSPSYETIGVGAPILLVFARLLQGLSVGGEYGTSATYL 153 AGRK A++ ++ L+ G++ +AL+PSY +IG+ API+++ RL+QGL++GGE G S TYL Sbjct: 102 AGRKPAMLLTIALITVGTIGMALTPSYASIGLAAPIIVIACRLVQGLALGGEVGPSTTYL 161 Query: 154 SEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQFLTTEQLYAWGWRIPFAIGALCAV 213 E+A + RRG + S+Q + L A V IVL L+ EQ+ AWGWRIPF +G Sbjct: 162 IEIAPQGRRGLYGSWQLASQGIASLAAGIVGIVLTLALSKEQMLAWGWRIPFLLGLALIP 221 Query: 214 VALYLRRGMEETESFTKKEKSKESAMRTLLRHPKELMTVVGLTMGGTLAFYTYTTYMQKY 273 +A++LRR M E+ +S + + H + +M + + +G T++ Y YM Y Sbjct: 222 IAVFLRRHMPESLEQPTHSGPIKSPLADIRHHLRPIMLALMVILGVTISTYA-AIYMTTY 280 Query: 274 LVNTVGMSISDSTTISAATLF-LFMCLQPVIGG-LSDKIGRRPILI--AFGILGTLFTVP 329 V T + +S + +SA +F + ++GG LSD GR+P+++ + ++ Sbjct: 281 AVTT--LKLSATIAMSATIVFGVATWAGALLGGWLSDLYGRKPVMLWARVALFVLVYPAY 338 Query: 330 ILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAVVKAELFPTEIRALGVGLPYALTVSIF 389 +L HT ++A L + G ++ A+ ELFP +RALG+ + YA V++F Sbjct: 339 MLLIEHTSVATLALATALLALLTGIGGAPTLVAI--PELFPGHVRALGLSIAYAFGVALF 396 Query: 390 GGTAEYIALWFKSI---GMETGYYWYVTACIAV 419 GGTA+ + W + Y +T+ IA+ Sbjct: 397 GGTAQLVITWLIKVTDNPAAPALYVLITSLIAI 429 Lambda K H 0.326 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 590 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 446 Length adjustment: 32 Effective length of query: 407 Effective length of database: 414 Effective search space: 168498 Effective search space used: 168498 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory