Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate WP_013518728.1 ALIDE2_RS10400 3-oxoacyl-ACP reductase
Query= SwissProt::Q9HK58 (254 letters) >NCBI__GCF_000204645.1:WP_013518728.1 Length = 263 Score = 118 bits (296), Expect = 1e-31 Identities = 83/258 (32%), Positives = 133/258 (51%), Gaps = 17/258 (6%) Query: 1 MLDFKGKNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHK 60 + D GK A++TGGSRG+G +A L + GA I++S + V E + G+ A Sbjct: 8 LFDLSGKTALVTGGSRGLGLQMAQALGEAGARIMLSSRKAEDLEQAVAELQAA-GIDARW 66 Query: 61 VKVDQSDPYESIRFAEKAIETFGKVHILVDNAGI---CPFEDFFRISVDLFEKVWKVNVE 117 + D + + R A + ++ G V ILV+NAG P ED + ++KV +NV Sbjct: 67 IAADCAREDDIQRLASETLQRMGDVDILVNNAGATWGAPAEDH---PLAAWDKVMNLNVR 123 Query: 118 SHYFITQRIAKNMIENKINGRILLISSISAHVGGEFQTH---YTTTKSALNGFMHSIAIV 174 ++ ++Q IAK+ + + GRI+ ++SI+ G F+ Y T+K A+ F ++A Sbjct: 124 GYFLLSQAIAKHSMIPRRGGRIINVASIAGLAGNPFEMKTIAYNTSKGAVLNFTRALAGE 183 Query: 175 LGKYGILVNSLEPG---TILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLL 231 G YGI VN++ PG T +T + E LS ++ + R RLG ED+ L Sbjct: 184 WGVYGICVNAICPGFFKTKMTTVLIETLSEEKMATHAPLR----RLGDDEDLKGITLLYA 239 Query: 232 SDDNTYVTGTELLADGGM 249 S+ ++TG L DGG+ Sbjct: 240 SEAGKHITGQWLAVDGGV 257 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 263 Length adjustment: 24 Effective length of query: 230 Effective length of database: 239 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory