Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_013519272.1 ALIDE2_RS13080 sulfate ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000204645.1:WP_013519272.1 Length = 375 Score = 194 bits (494), Expect = 3e-54 Identities = 113/289 (39%), Positives = 169/289 (58%), Gaps = 13/289 (4%) Query: 4 LKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEID 63 +++ V K +G + L +++LDIQ GELI +GPSGCGK+TLLR+IAGLE G++ Sbjct: 3 IEIRNVSKQFGSFQALRDVSLDIQSGELIALLGPSGCGKTTLLRIIAGLETPDTGSIHFS 62 Query: 64 GTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKI----AKKSQAEIDAAVEAAAE 119 G DV +RG+ VFQ YAL+ HMTV +N++F L++ + S+A+I V + Sbjct: 63 GENQTDVHVRERGVGFVFQHYALFRHMTVLDNVAFGLRMKPRRERPSEAQIRQKVMDLLK 122 Query: 120 KLQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQL 179 +QL DR P LSGGQRQR+A+ R++ +PKV L DEP LDA +R R + +L Sbjct: 123 LVQLDWIADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLRRL 182 Query: 180 KEAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPK 239 + + T ++VTHDQ EA+ +A R+VV+ G I Q G+P ++++ P + FV F+G Sbjct: 183 HDEL-HVTSIFVTHDQEEALEVADRVVVINQGRIEQQGTPQQVWDNPASPFVYGFLGD-- 239 Query: 240 MNLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDM 288 +NL G+ + + +G + D P GA VRP D+ Sbjct: 240 VNLFKGR----ANDGRIHLDEGMQL--DSPEARHADGAPAFAYVRPHDL 282 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 375 Length adjustment: 30 Effective length of query: 343 Effective length of database: 345 Effective search space: 118335 Effective search space used: 118335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory