Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate WP_013536844.1 THEAM_RS00425 nucleotide sugar epimerase
Query= BRENDA::Q9WYX9 (309 letters) >NCBI__GCF_000185805.1:WP_013536844.1 Length = 324 Score = 188 bits (478), Expect = 1e-52 Identities = 117/319 (36%), Positives = 172/319 (53%), Gaps = 22/319 (6%) Query: 2 NILVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENL----------NRNALFYEQS 51 ++L+TG AGFIG L+E GY VI VDNL++ L NRN FY Sbjct: 3 SVLLTGAAGFIGYRTAKLLLEKGYKVIGVDNLNNYYDPKLKEYRLNLLKENRNFKFYRLD 62 Query: 52 IEDEEMMERIFSLHRPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKK 111 IE+ E ++ +F + E + +LAA+A V S+ P TN +G+L LLE ++G+KK Sbjct: 63 IENFEALKVVFEENSFEGIINLAARAGVRYSIENPFVYETTNSLGTLNLLELMKEFGLKK 122 Query: 112 FIFSSTGGAIYGENVKVFPTPETE---IPHPISPYGIAKYSTEMYLEFFAREYGLKYTVL 168 F+ +ST G+ P P E + PISPY +K + E+ + YG TV+ Sbjct: 123 FVLASTSSLYAGQ-----PMPFKEDLPVNTPISPYAASKKAAEVMSYTYHYLYGFDVTVV 177 Query: 169 RYANVYGPRQDPYGEAGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAMEK 228 RY VYGP P + F + + G V ++GDG RD+ YVDD+ + A E Sbjct: 178 RYFTVYGPAGRPDMS---IFRFIKWIDEGRPVEVYGDGTQSRDFTYVDDIAEGTIRAYET 234 Query: 229 GDN-EVFNIGTGRGTTVNQLFKLLKEITGYDKEPVYKPPRKGDVRKSILDYTKAKEKLGW 287 ++ N+G R + ++ +L++E G E +YKP K D++ + D TKA+E LGW Sbjct: 235 ETGYQIINLGGNRPHQLKEVIRLIEEYLGKKAEIIYKPFHKADLKATWADITKAREILGW 294 Query: 288 EPKVSLEEGLKLTVEYFRK 306 EPKV LEEGL+ TVE+ ++ Sbjct: 295 EPKVPLEEGLRRTVEWHKE 313 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 324 Length adjustment: 27 Effective length of query: 282 Effective length of database: 297 Effective search space: 83754 Effective search space used: 83754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory