Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_013537410.1 THEAM_RS03320 UDP-glucose 4-epimerase GalE
Query= curated2:Q59745 (327 letters) >NCBI__GCF_000185805.1:WP_013537410.1 Length = 324 Score = 336 bits (862), Expect = 4e-97 Identities = 168/316 (53%), Positives = 214/316 (67%), Gaps = 1/316 (0%) Query: 6 VLVVGGAGYIGSHTCLDLANKGYRPVVFDNFSNGHREFVRWGPAEEGDIRDRARLDEVLA 65 +LV GGAGYIGSHT L KG+ + DN S GHRE V +G E D+ ++ +L E++ Sbjct: 3 ILVTGGAGYIGSHTVELLGRKGHIVLTVDNLSRGHREAVLFGELAEVDLSEKEKLKELIN 62 Query: 66 KHKPAAILHFAALIEVGESVKDPVSFYENNVIGTLTLLSAAQAAGINAFVFSSTCATYGL 125 +P A++HFAA IEVGESVKDP SFY NN L LL A +G+ F+FSST A YG Sbjct: 63 SFRPDAVIHFAAFIEVGESVKDPKSFYRNNTCNALNLLEAVVESGVKNFIFSSTAAVYGN 122 Query: 126 PQSVPLDETHRQVPINPYGRTKYIVEQALADYDQYGSLRSVVLRYFNAAGADFEGRIGEW 185 PQ VP+ E H + PINPYG +K VE+ L D+ L V LRYFNAAGAD +GRIGE Sbjct: 123 PQKVPIPEEHPKNPINPYGASKLAVERMLQDFHTAYGLNYVALRYFNAAGADPKGRIGES 182 Query: 186 HQPETHAIPLAIDAALGRRQGFKVFGSDYETRDGTCVRDYIHVLDLADAHVRAVEYLLKG 245 H PETH IPL + AA G R FK+FG+DY T DGTC+RD+IHV DLA+AH++A+EYL +G Sbjct: 183 HNPETHLIPLILKAAKGERDSFKIFGTDYPTPDGTCIRDFIHVCDLAEAHLKALEYLAEG 242 Query: 246 GDSVALNLGTGTGTTVKELLGAIEEVSNRPFPVEYIGRREGDSHTLVANNDKARDVLGWV 305 G+S ALN G GTG +VKE++ + V+ R F VE RR GD LVA+ + + L W Sbjct: 243 GESCALNCGYGTGHSVKEVVETAKRVTGREFKVEEAPRRPGDPPILVADTRRIEEKLNWK 302 Query: 306 PQY-DLSEIIRSAWDW 320 P++ DL II++AW+W Sbjct: 303 PKFNDLEYIIQTAWNW 318 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 324 Length adjustment: 28 Effective length of query: 299 Effective length of database: 296 Effective search space: 88504 Effective search space used: 88504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_013537410.1 THEAM_RS03320 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.30398.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-146 471.9 0.0 5.3e-146 471.6 0.0 1.0 1 lcl|NCBI__GCF_000185805.1:WP_013537410.1 THEAM_RS03320 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185805.1:WP_013537410.1 THEAM_RS03320 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 471.6 0.0 5.3e-146 5.3e-146 1 327 [. 2 321 .. 2 323 .. 0.99 Alignments for each domain: == domain 1 score: 471.6 bits; conditional E-value: 5.3e-146 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleee 69 +iLvtGgaGyiGsh+v l +kg+ v+++Dnls+g++ea+ +e l e dl++kekl++++++ lcl|NCBI__GCF_000185805.1:WP_013537410.1 2 RILVTGGAGYIGSHTVELLGRKGHIVLTVDNLSRGHREAVLFGE------LAEVDLSEKEKLKELINSF 64 69******************************************......9****************** PP TIGR01179 70 kidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesp 138 ++daviHfaa+i+vgEsvk+P +Y+nn+ n+l+Llea+++ gvk++iFss+aavYg+++kvpi Ee+p lcl|NCBI__GCF_000185805.1:WP_013537410.1 65 RPDAVIHFAAFIEVGESVKDPKSFYRNNTCNALNLLEAVVESGVKNFIFSSTAAVYGNPQKVPIPEEHP 133 ********************************************************************* PP TIGR01179 139 lnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkr 207 npinpYG+skl+vEr+l+d+++a ++l++v+LRYFn+aGAd++g+iGe+++++thli+l++++a g+r lcl|NCBI__GCF_000185805.1:WP_013537410.1 134 KNPINPYGASKLAVERMLQDFHTA-YGLNYVALRYFNAAGADPKGRIGESHNPETHLIPLILKAAKGER 201 ************************.******************************************** PP TIGR01179 208 ekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsg 276 ++++ifGtdypt+DGtc+RD+iHv+DlaeaHl+ale+l+egges ++n+G+g+g+svkev+e++k+v+g lcl|NCBI__GCF_000185805.1:WP_013537410.1 202 DSFKIFGTDYPTPDGTCIRDFIHVCDLAEAHLKALEYLAEGGESCALNCGYGTGHSVKEVVETAKRVTG 270 ********************************************************************* PP TIGR01179 277 kdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekk 327 +++kve+a+rR+GDp+ lvad+ +i+++l+wkpk++dLe ii++aw+We + lcl|NCBI__GCF_000185805.1:WP_013537410.1 271 REFKVEEAPRRPGDPPILVADTRRIEEKLNWKPKFNDLEYIIQTAWNWELN 321 ************************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.29 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory