Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_013554275.1 NITSA_RS06765 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000186245.1:WP_013554275.1 Length = 264 Score = 90.5 bits (223), Expect = 3e-23 Identities = 81/268 (30%), Positives = 118/268 (44%), Gaps = 29/268 (10%) Query: 9 KGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNN--CVFAPADVT 66 +G ITGGA G+G AT + +G+GAS +D S +A +K GN+ ++ D Sbjct: 10 EGKTLFITGGAKGIGAATVQAFLGKGASVCFVDRDESAAKAFLRKQGNSERLLYIAGDTR 69 Query: 67 SEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTF 126 + ++ A A +FG +D V+ AGI + L + +Q +LD+NL GT+ Sbjct: 70 DARRMEEAAEEAVERFGGLDFVVSNAGI------HRLGTILETDPQVWQELLDINLTGTY 123 Query: 127 NVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDL 186 N +R + GG +I S +F G+ AY A+KG I M +A D Sbjct: 124 NTLRATLPHLIAR---HGGCMTLI---GSDQSFIGKRRSFAYGATKGAIGQMAASLALDY 177 Query: 187 APIGIRVMTIAPGLFGTPLLTSLPEKVC------------NFLASQVPFPSRLGDPAEYA 234 AP IRV + PG T L ++ A Q P R+G P E A Sbjct: 178 APEKIRVNCVCPGTIDTDLYRQAIAQIAAEEYGGDLREAERHSALQQPL-GRIGTPQEVA 236 Query: 235 HLV--QAIIENPFLNGEVIRLDGAIRMQ 260 +V A E F+ G I +DG Q Sbjct: 237 AMVLFLASPEAGFITGARIPVDGGYTAQ 264 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 264 Length adjustment: 25 Effective length of query: 236 Effective length of database: 239 Effective search space: 56404 Effective search space used: 56404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory