Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate WP_013554342.1 NITSA_RS07120 UDP-glucose 4-epimerase GalE
Query= metacyc::BSU38860-MONOMER (339 letters) >NCBI__GCF_000186245.1:WP_013554342.1 Length = 343 Score = 444 bits (1141), Expect = e-129 Identities = 216/335 (64%), Positives = 267/335 (79%), Gaps = 3/335 (0%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 I VTGGAGYIGSHTCVELLN+GY+++V DNLSN+S E L RV++ITGK LTF + D+ D Sbjct: 11 IFVTGGAGYIGSHTCVELLNAGYDVIVYDNLSNASKEVLRRVEKITGKPLTFVKGDIRDG 70 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 + ++ A +AVIHFAGLKAVGESV PL+YY NN+ GT L ++M+K G+K IVFS Sbjct: 71 DTLEE--AMQGCDAVIHFAGLKAVGESVEKPLEYYDNNVCGTVTLLKSMQKIGLKAIVFS 128 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTAD-NEWSVALLRYFNPFG 181 SSATVYG PE P+TE+ PL TNPYGQTKL++E+ILRDL+ AD + W +++LRYFNP G Sbjct: 129 SSATVYGDPEFLPLTEEHPLRTTNPYGQTKLVIEEILRDLYRADPSSWRISILRYFNPVG 188 Query: 182 AHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEG 241 AH SG IGEDP GIPNNLMP+V+QVAVG+ ++L VFG DY T DGTGVRDYIHVVDLA G Sbjct: 189 AHESGLIGEDPRGIPNNLMPFVSQVAVGRRDELQVFGGDYDTHDGTGVRDYIHVVDLARG 248 Query: 242 HVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFAD 301 H+ AL+ + ++ +A NLGTG GYSVL++VKAFEK SGK+VPYR RRPGDIATC+A+ Sbjct: 249 HLAALKTLESAPQCEAVNLGTGKGYSVLDVVKAFEKASGKKVPYRITTRRPGDIATCYAN 308 Query: 302 PAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYK 336 P KAK LGWEA+ GLE+MC D+W +QS+N G + Sbjct: 309 PGKAKELLGWEAQYGLEKMCEDTWNFQSNNPEGIR 343 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 343 Length adjustment: 29 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_013554342.1 NITSA_RS07120 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.1391.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-139 449.7 0.0 2.9e-139 449.5 0.0 1.0 1 lcl|NCBI__GCF_000186245.1:WP_013554342.1 NITSA_RS07120 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000186245.1:WP_013554342.1 NITSA_RS07120 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 449.5 0.0 2.9e-139 2.9e-139 1 331 [. 10 341 .. 10 342 .. 0.98 Alignments for each domain: == domain 1 score: 449.5 bits; conditional E-value: 2.9e-139 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavle 67 ki vtGgaGyiGsh++++ll++g++v+v+Dnls++ske+l+++ekit +++v+gd++d +le++++ lcl|NCBI__GCF_000186245.1:WP_013554342.1 10 KIFVTGGAGYIGSHTCVELLNAGYDVIVYDNLSNASKEVLRRVEKITgkPLTFVKGDIRDGDTLEEAMQ 78 699*******************************************9999****************985 PP TIGR01179 68 eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEe 136 daviHfa+l+avgEsv++Pl+YY+nnv +t++Ll++mqk+g+k ++Fsssa+vYg++e +p++Ee lcl|NCBI__GCF_000186245.1:WP_013554342.1 79 --GCDAVIHFAGLKAVGESVEKPLEYYDNNVCGTVTLLKSMQKIGLKAIVFSSSATVYGDPEFLPLTEE 145 ..79***************************************************************** PP TIGR01179 137 splnpinpYGrsklmvErilkdlkkad.kelkvviLRYFnvaGAdeegeiGeasknat.hliklvaeva 203 +pl ++npYG++kl++E+il+dl +ad +++++ iLRYFn++GA+e+g iGe++++++ +l++ v +va lcl|NCBI__GCF_000186245.1:WP_013554342.1 146 HPLRTTNPYGQTKLVIEEILRDLYRADpSSWRISILRYFNPVGAHESGLIGEDPRGIPnNLMPFVSQVA 214 ************************999357****************************9********** PP TIGR01179 204 vgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavk 272 vg+r++l++fG+dy+t+DGt+vRDyiHv Dla +Hlaal++le+ + e+ nlG+g+g+sv++v++a++ lcl|NCBI__GCF_000186245.1:WP_013554342.1 215 VGRRDELQVFGGDYDTHDGTGVRDYIHVVDLARGHLAALKTLESAPQCEAVNLGTGKGYSVLDVVKAFE 283 ********************************************************************* PP TIGR01179 273 kvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 k+sgk+++++++ rR+GD+a+++a++ k+k+ lgw+++y+ Le++++++w+++++++eg lcl|NCBI__GCF_000186245.1:WP_013554342.1 284 KASGKKVPYRITTRRPGDIATCYANPGKAKELLGWEAQYG-LEKMCEDTWNFQSNNPEG 341 ****************************************.*************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.50 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory