Align UDP-glucose 4-epimerase; UDP-galactose 4-epimerase; Uridine diphosphate galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_013554926.1 NITSA_RS10070 NAD-dependent epimerase
Query= SwissProt::A0R5C5 (313 letters) >NCBI__GCF_000186245.1:WP_013554926.1 Length = 351 Score = 132 bits (333), Expect = 9e-36 Identities = 104/350 (29%), Positives = 164/350 (46%), Gaps = 45/350 (12%) Query: 1 MRTLVTGAAGFIGSTLVDRLLADGHGVVGLDDLSS--------GRAENLH---------- 42 M+ LVTG AGFIG L RLL G VVGLD+++ GR Sbjct: 1 MKILVTGTAGFIGFHLAKRLLERGDEVVGLDNINDYYDPKVKYGRLRETGIEGDEAIEYA 60 Query: 43 ---SAENSDKFEFVKADIVD-ADLTGLLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNV 98 + + + F+K ++ D A + L + + + + +LAAQ V+ S+ +P N+ Sbjct: 61 KPVQSSRYENYRFIKLNLEDRAAIEELFEKERFDAVCNLAAQAGVRYSLTNPHAYVDSNI 120 Query: 99 VGTVRLAEAARLAGVRKVVHTSSGGSVYGTPPAYP-TSEDMPVNPASPYAAGKVAGEVYL 157 VG V + EA R GV + + SS SVYG P ++ D +P S YAA K + E+ Sbjct: 121 VGFVNILEACRHNGVGHLAYASS-SSVYGLNETMPFSTHDNVDHPISLYAASKKSNELMA 179 Query: 158 NMYRNLYDLDCSHIAPANVYGPRQDPHGEAGVVAIFSEALLAGRTTKIFGDGSDTRDYVF 217 + Y +LY L + + VYGP P + +F++A+L R ++ G RD+ + Sbjct: 180 HTYSHLYGLPTTGLRFFTVYGPWGRPD---MALFLFTKAILEDRPIDVYNYGEMQRDFTY 236 Query: 218 VDDVVDAFVRA------GGPAGGGQR------------FNVGTGVETSTRELHTAIAGAV 259 VDD+V+ VR G P G+ +N+G + TAI A+ Sbjct: 237 VDDIVEGLVRVIDHPPKGNPEWSGKAPDPGSSRAPYKIYNIGNNNPVKLMDFITAIEEAI 296 Query: 260 GAPDEPEFHPPRLGDLRRSRLDNTRAREVLGWQPQVALAEGIAKTVEFFR 309 G + P + GD+ + D + E LG++P+ + EGI + VE++R Sbjct: 297 GKEAKKNLLPIQPGDVPATYADVSDLIEDLGYKPETPIKEGINRFVEWYR 346 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 351 Length adjustment: 28 Effective length of query: 285 Effective length of database: 323 Effective search space: 92055 Effective search space used: 92055 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory