Align Imidazole glycerol phosphate synthase subunit HisH; IGP synthase glutaminase subunit; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH; EC 4.3.2.10; EC 3.5.1.2 (characterized)
to candidate WP_013643643.1 METBO_RS00185 imidazole glycerol phosphate synthase subunit HisH
Query= SwissProt::Q7SIC0 (200 letters) >NCBI__GCF_000191585.1:WP_013643643.1 Length = 203 Score = 130 bits (327), Expect = 2e-35 Identities = 77/194 (39%), Positives = 102/194 (52%), Gaps = 12/194 (6%) Query: 7 LIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVE 66 +IDYGSGNL+S G S ++ ++AD LVLPG G FG M + + E Sbjct: 4 IIDYGSGNLKSIKNGFSKIGTSTHISSSINEIKDADALVLPGVGAFGNAMEGV--ASYQE 61 Query: 67 RVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAG------RVPQMG 120 + H+ G PFLGIC+G+Q+L+ SEE+P GL +V G V F ++PQMG Sbjct: 62 AIHDHIHDGKPFLGICLGLQILFTRSEESPDTTGLDVVEGSVLHFPDSIKESGLKIPQMG 121 Query: 121 WNALEFGGAFAPLTG---RHFYFANSYY-GPLTPYSLGKGEYEGTPFTALLAKENLLAPQ 176 WN L+ G L G YF +SYY P P + G A++ K+N+ A Q Sbjct: 122 WNQLQIRGECPILKGIGSDFMYFVHSYYVAPDDPDVVVATVDYGIDVPAVICKDNVYATQ 181 Query: 177 FHPEKSGKAGLAFL 190 FHPEKSG GL L Sbjct: 182 FHPEKSGDKGLKIL 195 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 200 Length of database: 203 Length adjustment: 21 Effective length of query: 179 Effective length of database: 182 Effective search space: 32578 Effective search space used: 32578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_013643643.1 METBO_RS00185 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.18771.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.18771.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.