Align acetohydroxy-acid synthase small subunit (EC 2.2.1.6) (characterized)
to candidate WP_013643697.1 METBO_RS00455 acetolactate synthase small subunit
Query= metacyc::MONOMER-11901 (169 letters) >NCBI__GCF_000191585.1:WP_013643697.1 Length = 166 Score = 197 bits (502), Expect = 6e-56 Identities = 98/161 (60%), Positives = 129/161 (80%) Query: 4 THIISVLVLNKPGVLQRISGLFTRRWYNISSITGGSTDSTDISRMTIVVKGDDKVVEQVV 63 +H+IS LVL+KPGVLQR++GLFTRR +NI +IT G +++ ++RMTI+ KGD+KV+EQ+ Sbjct: 6 SHVISALVLHKPGVLQRVAGLFTRRGFNIETITVGPSENEGLARMTIISKGDEKVLEQIT 65 Query: 64 KQLNKLIEVIKVIDLDEEECVERELCLIKIYAPTESSKSQVIQYANIFRGNIVDLSQESL 123 KQLNKLI+VIKV DL+ V+RELCLIK++ TE ++S+VIQY NIFRG +VD+S E+L Sbjct: 66 KQLNKLIDVIKVRDLEPGITVKRELCLIKVHTATEKARSEVIQYTNIFRGRVVDVSPETL 125 Query: 124 TVQITGDKTKISAFIKLVKPMGIKEISRTGLTALMRGPKIL 164 TV+ITGD KI A I LV GIKEI+RTG TA+ RG K + Sbjct: 126 TVEITGDPEKIEALIDLVSVFGIKEIARTGPTAITRGTKTI 166 Lambda K H 0.317 0.134 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 169 Length of database: 166 Length adjustment: 18 Effective length of query: 151 Effective length of database: 148 Effective search space: 22348 Effective search space used: 22348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_013643697.1 METBO_RS00455 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.9612.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.9612.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.