Align Phosphoglucomutase/phosphomannomutase; PGM/PMM; EC 5.4.2.2; EC 5.4.2.8 (characterized)
to candidate WP_013683858.1 ARCVE_RS05920 phosphoglucosamine mutase
Query= SwissProt::Q68BJ6 (456 letters) >NCBI__GCF_000194625.1:WP_013683858.1 Length = 451 Score = 422 bits (1084), Expect = e-122 Identities = 212/454 (46%), Positives = 301/454 (66%), Gaps = 12/454 (2%) Query: 2 GKLFGTFGVRGIANEEITPEFALKIGMAFGTLLKREGRERPLVVVGRDTRVSGEMLKDAL 61 G+LFGT GVRGIANEE+T E AL +G GT+ R GR + VG D R+S M K A+ Sbjct: 8 GELFGTDGVRGIANEELTVEMALNLGRVMGTI--RSGR----IAVGMDARISSHMFKSAV 61 Query: 62 ISGLLSTGCDVIDVGIAPTPAIQW-ATNHFNADGGAVITASHNPPEYNGIKLLEPNGMGL 120 I+G+ STG DVID+G+ PTPA+Q+ + GG V+TASHNP EYNGIK ++ +G Sbjct: 62 IAGITSTGSDVIDLGLIPTPALQYYVKTNPKITGGIVVTASHNPREYNGIKFIQDDGREF 121 Query: 121 KKEREAIVEELFFSEDFHRAKWNEIGELRKEDIIKPYIEAIKNRVDVEAIKKRRPFVVVD 180 +E + E ++ S+ + A W ++G++ ED + YI+ IK++V VE I + VVVD Sbjct: 122 TREMDEESERMYKSKTYRIASWQDVGQVYSEDCKRQYIDGIKDKVSVEEIAGKAFKVVVD 181 Query: 181 TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKGFMEIVKALGADFGV 240 NGAG +T P LL+ELGC V+S+NAHPDG FPARNPEP EEN++ ++V A+ GV Sbjct: 182 CGNGAGCVTTPQLLKELGCTVISINAHPDGRFPARNPEPVEENVEQLKKVVAETNANLGV 241 Query: 241 AQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLLDDIAKRNGA 300 A DGDADRA F+DE G+F+ D AL+A + +NGGG++VT +++S ++D + G Sbjct: 242 AHDGDADRATFVDERGQFVSEDVMLALMAKYYVEKNGGGVVVTPVSSSRCVEDAVREAGG 301 Query: 301 KVMRTKVGDLIVARALLENNGTIGGEENGGVIFPDFVLGRDGAMTTAKIVEIFAKSGKKF 360 +++ T VG +VA +L+ GGE NGG+IFP+ +L RDGAM+ AK++E+ A GK Sbjct: 302 EIVYTPVGSPVVAETMLKTKAVFGGEGNGGLIFPEHLLARDGAMSAAKVLELMALEGKPL 361 Query: 361 SELIDELPKYYQFKTKRHVEGDRKAIVAKVAELAEKKGYKIDTTDGTKIIFDDGWVLVRA 420 SEL+ ++P+YY FKTK + K + E E TDG +I ++DGW+L+R Sbjct: 362 SELVKDIPRYYTFKTKVPCKDKLKLLNGLKEEFPE-----ASFTDGARIDYEDGWLLIRP 416 Query: 421 SGTEPIIRIFSEAKSEEKAREYLELGIKLLEEAL 454 SGTEPI RIF+E K+E++A+E LELG+ +++ L Sbjct: 417 SGTEPIARIFAEGKTEKRAKELLELGMSAVKKIL 450 Lambda K H 0.317 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 451 Length adjustment: 33 Effective length of query: 423 Effective length of database: 418 Effective search space: 176814 Effective search space used: 176814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory