Protein WP_013705968.1 in Desulfobacca acetoxidans DSM 11109
Annotation: NCBI__GCF_000195295.1:WP_013705968.1
Length: 712 amino acids
Source: GCF_000195295.1 in NCBI
Candidate for 26 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-lysine catabolism | hisP | med | ABC transporter for L-Lysine, ATPase component (characterized) | 40% | 90% | 144.4 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-glucosamine (chitosamine) catabolism | AO353_21725 | med | ABC transporter for D-glucosamine, ATPase component (characterized) | 40% | 85% | 142.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-histidine catabolism | PA5503 | lo | Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) | 39% | 69% | 162.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-arginine catabolism | artP | lo | ABC transporter for L-Arginine, putative ATPase component (characterized) | 39% | 95% | 156 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-asparagine catabolism | bgtA | lo | ATPase (characterized, see rationale) | 40% | 90% | 151.4 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-aspartate catabolism | bgtA | lo | ATPase (characterized, see rationale) | 40% | 90% | 151.4 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-citrulline catabolism | PS417_17605 | lo | ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) | 39% | 88% | 150.2 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-histidine catabolism | hisP | lo | Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) | 40% | 88% | 149.4 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 92% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 92% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 92% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 92% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 92% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 92% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-citrulline catabolism | AO353_03040 | lo | ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) | 35% | 100% | 141.4 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-histidine catabolism | BPHYT_RS24015 | lo | ABC transporter related (characterized, see rationale) | 38% | 88% | 138.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 38% | 92% | 138.3 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-asparagine catabolism | aatP | lo | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 39% | 97% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-aspartate catabolism | aatP | lo | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 39% | 97% | 137.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 37% | 62% | 136 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-histidine catabolism | aapP | lo | ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) | 37% | 90% | 132.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 34% | 60% | 132.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 34% | 60% | 132.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 35% | 67% | 127.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
glycerol catabolism | glpS | lo | ABC transporter for Glycerol, ATPase component 1 (characterized) | 32% | 76% | 122.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
L-tryptophan catabolism | ecfA1 | lo | Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) | 35% | 76% | 117.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 37% | 305.1 |
Sequence Analysis Tools
View WP_013705968.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKLIELHNVYKTYQLGEIEVPVLKGVSLTISQGEFVALMGTSGSGKTTLMNILGCLDRPT
SGQYWLDGLDVTALTPDERAYLRNRKLGFVFQIFNLLPRTSALENVIVPLSYNGFDISDR
QAHQRAQDLLERMGLSTRVDYEPSQLSGGQQQRVAIARALVNSPPVLLADEPTGNLDSQT
SEEVLVLFQRLNAEGVTIILVTHDENVARHAGRIIRINDGVAETVELAAEPDAKDSYGPR
AEKSQPHSHTSLPRLRWMLRTALNGLRRNILRAALTALGIIIGVAAVIAMMEIGRGSADA
IQRTIASMGANNLIIFPGTASSGGVTFGMGAAMTLTPQDVEAILRECPAVKAAAPIVRAR
IQIVYGNRNWVPIYIFGTTPAFLDVREWPLEAGEPLTEQDVRNVSKVCLLGKRLVRELFG
GEDPLNKEIRVNNIIFKVVGVLSSKGANMIGMDQDDILVAPWTTIRYRVTRSSLTNVNQS
AKQTTSTSSTSEKVNTLNELYPSTQLSLYPARSTSQEANNPMPVRFANVDQIMVAAHSTQ
DIPRAIQQITQLLRERHRIRPGEPEDFNIRDMTEPSRALSSTATLMTKLLLAVALISLVV
GGVGIMNIMLVSVTERTREIGLRLAVGARSRDILKQFLTEAVLLCFCGGIVGILFGRGAS
MVITTVFGWPTGISPLAILAAFAVSVTVGVTFGYYPAWKASRLDPINALRYE
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory