Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate WP_013706791.1 DESAC_RS09195 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >NCBI__GCF_000195295.1:WP_013706791.1 Length = 294 Score = 235 bits (599), Expect = 1e-66 Identities = 131/292 (44%), Positives = 179/292 (61%), Gaps = 23/292 (7%) Query: 116 IATLILIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGM 175 +A + +Y++L L LN+++G G + LG+ FY +GAYS AL++ ++ F + L A + Sbjct: 8 LAIISCLYIILALSLNLIIGYCGQVSLGHAAFYGLGAYSSALVAIHWHFPFLLALLTAMI 67 Query: 176 MAATFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGL 235 +AA FG LG P LRL+ DYLAIVTLGFG II L L NL DITGGP+GI+ I PT F L Sbjct: 68 VAALFGLSLGIPTLRLKDDYLAIVTLGFGVIIDLVLLNL-DITGGPDGITRIPAPTMFDL 126 Query: 236 TFERKAAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEAL 295 F K +L LV L +AL LF I+RL+ GRA +A+ Sbjct: 127 NFRLKGW---------------------YLMLVVLAVALTLLF-IHRLVNSRHGRALKAI 164 Query: 296 REDEIACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIV 355 R+ EI +G+N K++ F L A AG AGS +A + PESF S +IL +V Sbjct: 165 RDHEITANVMGINTAAYKIAIFALSAGLAGLAGSLYAHYITFINPESFGLHTSILILTMV 224 Query: 356 VLGGMGSQLGVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLL 407 VLGGMGS LG +L A ++ LPEM+R F++Y+ L +G L+++M+IWRPQGLL Sbjct: 225 VLGGMGSILGSVLGACILTALPEMLRRFADYQDLAYGGLLIVMLIWRPQGLL 276 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 294 Length adjustment: 29 Effective length of query: 389 Effective length of database: 265 Effective search space: 103085 Effective search space used: 103085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory