Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate WP_013707468.1 DESAC_RS12645 UDP-glucose 4-epimerase
Query= BRENDA::Q9WYX9 (309 letters) >NCBI__GCF_000195295.1:WP_013707468.1 Length = 312 Score = 274 bits (701), Expect = 2e-78 Identities = 152/305 (49%), Positives = 202/305 (66%), Gaps = 4/305 (1%) Query: 3 ILVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENLNRNALFYEQSIEDEEMMERIF 62 ILVTGGAGFIGSHV + + G+ V +VDNLS+G+ +N+ A FY I+ E + F Sbjct: 6 ILVTGGAGFIGSHVAESFLAAGHEVAIVDNLSTGRQDNVPVGAQFYPFDIKSWETFD--F 63 Query: 63 SLH-RPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKKFIFSSTGGAI 121 H +P+ + H AAQ SV ISV +P RDA+ NI+GSL L E +++ V+K IF+STGGA+ Sbjct: 64 IRHWQPQVLVHHAAQMSVRISVDDPVRDAQENILGSLNLFEAAVQGKVEKIIFASTGGAM 123 Query: 122 YGENVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYANVYGPRQDPY 181 YG+ V P E + P PYGIAK + E Y+ F+ RE+G+ LRYANVYGPRQ+ Sbjct: 124 YGDQAPV-PAGEEDRATPECPYGIAKLAVEHYMHFYHREHGVIPIRLRYANVYGPRQNGL 182 Query: 182 GEAGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAMEKGDNEVFNIGTGRG 241 GEAGVVAIF E+ L E+ I GDG RD+VYV D+V ANLLA+E FNIGTG Sbjct: 183 GEAGVVAIFIEKFLAQEQPVINGDGLQTRDFVYVGDIVAANLLALEYSQAGTFNIGTGGE 242 Query: 242 TTVNQLFKLLKEITGYDKEPVYKPPRKGDVRKSILDYTKAKEKLGWEPKVSLEEGLKLTV 301 T + ++ L+EI G K PV+ P + G+ R+S LD T A ++LGW P+++L EGL TV Sbjct: 243 TDILTIYLKLQEILGSKKGPVHGPTKPGEQRRSALDSTLAHKELGWRPRINLVEGLTRTV 302 Query: 302 EYFRK 306 E F++ Sbjct: 303 EAFQQ 307 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 312 Length adjustment: 27 Effective length of query: 282 Effective length of database: 285 Effective search space: 80370 Effective search space used: 80370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory