Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_013723230.1 ALIDE2_RS22605 putative 2-aminoethylphosphonate ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000204645.1:WP_013723230.1 Length = 377 Score = 213 bits (542), Expect = 7e-60 Identities = 137/363 (37%), Positives = 215/363 (59%), Gaps = 18/363 (4%) Query: 4 LKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEID 63 L++ G+ K + + L +I+L ++QGE++ F+GPSGCGK+TLLR+IAGLE T G++ Sbjct: 20 LEIKGIHKNFENFSALRDIDLTVRQGEMLCFLGPSGCGKTTLLRIIAGLETQTSGSIVQS 79 Query: 64 GTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQL 123 G ++ +P ++R +VFQSYAL+P++T+ EN+++ L K +AEI A V L Sbjct: 80 GRDISWLPASERDYGIVFQSYALFPNLTIAENVAYGLVNGKMRKAEIQARVAELLAMAGL 139 Query: 124 GQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEAM 183 + P LSGGQ+QRVA+ R++ +P + L DEPLS LDA +RV R EI +L++ + Sbjct: 140 PTAGGKYPSQLSGGQQQRVALARALATNPGLLLLDEPLSALDATVRVRLRAEIRRLQKQV 199 Query: 184 PESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKMNLL 243 +T + VTHDQ EA++++ RIVV+ G I QVG+P+E+YE+P + FVA F+G K+N+L Sbjct: 200 GITT-IMVTHDQEEALSMSDRIVVMNHGVIEQVGTPMEIYERPASPFVANFVG--KVNVL 256 Query: 244 PGKIIGTGAQTTVEMTDGGRAVSDYPSDDSL-MGAAVNVGVRPEDMV--EAAPGGDYVFE 300 G+ +G G + V G + S+ S +G V++ +RPED V G Y Sbjct: 257 RGQALG-GKRFRV----GKMEIECEASEGSFRLGEDVSLYLRPEDRVAEHLEAGTPYRLG 311 Query: 301 GKVAITEALGEVTLLYFEAPSGEDPTIG---KLQGIHKDL---KGQVTRLTAEPAKVHVF 354 V E LG + + A + ++G L +H DL +G+ + +++ VF Sbjct: 312 VLVNKVEFLGGLCIAEVSAEALGGQSLGLHFSLNQMH-DLGICEGRRIDIALRASRIRVF 370 Query: 355 KDG 357 G Sbjct: 371 STG 373 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 377 Length adjustment: 30 Effective length of query: 343 Effective length of database: 347 Effective search space: 119021 Effective search space used: 119021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory