Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; L-KDR 4-dehydrogenase; EC 1.1.1.401 (characterized)
to candidate WP_013817788.1 METME_RS05495 3-oxoacyl-ACP reductase FabG
Query= SwissProt::Q1NEI6 (249 letters) >NCBI__GCF_000214665.1:WP_013817788.1 Length = 242 Score = 129 bits (323), Expect = 7e-35 Identities = 76/238 (31%), Positives = 130/238 (54%), Gaps = 6/238 (2%) Query: 11 RCAIVTGGASGLGKQVAARIIAEGGAV---ALWDLNGDALAATQAEIDATHVVALDVSDH 67 + AIVTG + G+G+ +A +++ +G V A D +A++A E + L+V+D Sbjct: 4 KLAIVTGASRGIGRAIAEKLVTDGFFVVGTATSDSGAEAISAYLGENGKGY--KLNVADA 61 Query: 68 AAVAAAAKDSAAALGKVDILICSAGITGATVPVWEFPVDSFQRVIDINLNGLFYCNREVV 127 A + K + A G +L+ +AGIT + + + + +I NL +F ++ V+ Sbjct: 62 ADIENFIKTTGDAHGTPAVLVNNAGITRDNL-LMRMKDEEWDDIISTNLTSVFRMSKAVL 120 Query: 128 PFMLENGYGRIVNLASVAGKEGNPNASAYSASKAGVIGFTKSLGKELAGKGVIANALTPA 187 M++ YGRI+N++SV G GN + Y+A+KAG++GF KS+ KE+ +G+ N + P Sbjct: 121 RGMMKVRYGRIINISSVVGSTGNAGQTNYAAAKAGMVGFAKSMAKEVGSRGITVNTVAPG 180 Query: 188 TFESPILDQLPQSQVDYMRSKIPMGRLGLVEESAAMVCFMASEECSFTTASTFDTSGG 245 ++ + +L + + I +GRLG EE A V F+ASE S+ T T +GG Sbjct: 181 FIDTDMTKELSDDIKNALLGSIALGRLGRPEEIAHAVSFLASEHASYITGETLHVNGG 238 Lambda K H 0.318 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 242 Length adjustment: 24 Effective length of query: 225 Effective length of database: 218 Effective search space: 49050 Effective search space used: 49050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory