Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_013840430.1 DESRU_RS01865 acetolactate synthase small subunit
Query= BRENDA::P9WKJ3 (168 letters) >NCBI__GCF_000215085.1:WP_013840430.1 Length = 170 Score = 160 bits (405), Expect = 1e-44 Identities = 80/156 (51%), Positives = 113/156 (72%) Query: 7 TLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQITKQ 66 TL+VLVE+ PGVLARVA LFSRRG+NI+SL VG TE SRMTIVV +D LEQ+TKQ Sbjct: 4 TLAVLVENSPGVLARVAGLFSRRGYNIDSLTVGRTENPAISRMTIVVEGDDRILEQVTKQ 63 Query: 67 LNKLINVIKIVEQDDEHSVSRELALIKVQADAGSRSQVIEAVNLFRANVIDVSPESLTVE 126 L+KL++VIKI + V RE+ +IKV AD+ SR ++++ +FRA+++D +LT+E Sbjct: 64 LHKLVDVIKINDITGSPHVDREMVIIKVGADSASRGEIMQITQIFRASIVDYGHRNLTIE 123 Query: 127 ATGNRGKLEALLRVLEPFGIREIAQSGMVSLSRGPR 162 TGN+ K+ A L PFGI+E+ ++G +++ RG + Sbjct: 124 CTGNQEKISAFEEALRPFGIKELVRTGKIAVLRGSK 159 Lambda K H 0.315 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 170 Length adjustment: 18 Effective length of query: 150 Effective length of database: 152 Effective search space: 22800 Effective search space used: 22800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_013840430.1 DESRU_RS01865 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.10837.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.10837.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.