Align hexokinase (EC 2.7.1.1) (characterized)
to candidate WP_013840668.1 DESRU_RS03105 hexokinase
Query= BRENDA::Q6X271 (513 letters) >NCBI__GCF_000215085.1:WP_013840668.1 Length = 446 Score = 217 bits (552), Expect = 8e-61 Identities = 152/443 (34%), Positives = 229/443 (51%), Gaps = 45/443 (10%) Query: 78 QEMYAGLASEGGSDQLKMLPTYVENLPSGSEKGLFYAVDLGGTNFRVLRVELGGKTGQIL 137 QEM AG GG+ LKMLPT++ N P G E G F+++D GGTN R+ V+L G+ + Sbjct: 31 QEMMAG---SGGNSSLKMLPTFL-NKPVGQETGTFFSIDFGGTNVRLQIVQLLGRGLYEI 86 Query: 138 SQEFKEVVIPPELMVG------TGKDLFDFIAGTLASFVDTEDESIKAHFVQSGKTRESG 191 Q ++I P + T DLFDFIA + +D G T G Sbjct: 87 KQSRSFLLIDPSGLYNYTSKQTTAADLFDFIAHRIKEMIDP------------GSTYLLG 134 Query: 192 FAFSFPVRQTSVKSGIVIHWTKGFKVDDAVGKDIVKQFQDAISRSNHQIMIS--ALVNDT 249 FSFP RQ ++I+WTK F G ++ + A+ R NH + I A++NDT Sbjct: 135 HTFSFPCRQLDANRAVLINWTKEFNTAGVEGHEVTGLLEQALHR-NHMVNIKPVAIINDT 193 Query: 250 VGTLAGGRFNFDEETMIGCIIGTGTNACYVERADAVHKWDEPLPKSGE-MVINMEWGNFR 308 TL + + IG I GTG N CY+E D P +G+ M+IN+E GNF Sbjct: 194 TATLLTASYA-NPRAHIGSICGTGHNTCYIEPKD---------PLTGQSMIINLESGNFN 243 Query: 309 SPYLPRTFADETVDKDSVNPGDQWFEKMISGMYLGEIVRLVLARMAKEAELFGGNVPVKL 368 +P T D +D+ S +PG Q+ EK +SG Y+GEIVRL+L + LF +P + Sbjct: 244 K--IPLTPFDSMLDQSSEDPGQQFLEKAVSGRYIGEIVRLILGHLISSNLLFFRQIPDFM 301 Query: 369 LERLTLGTPHVSKIHLDNSPDLDVVAKVLKDVFEIETTTLEERKIVHEVCDIMGERGGRL 428 ++ +S D +P L+ +++ L + I ++LEER+ + V ++ R +L Sbjct: 302 ERPHSIKAVDLSCFLEDRTPHLEKISQWLNSNWGIFYSSLEERQALKTVAALVTARSAQL 361 Query: 429 AAAGLYGILKKIGRTGKSRNGSKKKTVIAMDGGLFEHHVRYRSYMEEALQELMGSDAAYE 488 AA GIL++I +S + +IA+DG LFE + S+++E L S+ +++ Sbjct: 362 VAATYIGILQQIDPELRSDH------IIAVDGTLFEKMNSFTSHVQEILTGFY-SNCSHK 414 Query: 489 VALRLQNDGSGIGAALLAASHSH 511 V L+L GSG+GAA+ AA+ H Sbjct: 415 VTLKLTRGGSGVGAAIAAATTLH 437 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 22 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 513 Length of database: 446 Length adjustment: 34 Effective length of query: 479 Effective length of database: 412 Effective search space: 197348 Effective search space used: 197348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory