Align acetohydroxy-acid synthase small subunit (EC 2.2.1.6) (characterized)
to candidate WP_013840791.1 DESRU_RS03735 acetolactate synthase small subunit
Query= metacyc::MONOMER-11901 (169 letters) >NCBI__GCF_000215085.1:WP_013840791.1 Length = 171 Score = 150 bits (378), Expect = 1e-41 Identities = 74/161 (45%), Positives = 113/161 (70%) Query: 5 HIISVLVLNKPGVLQRISGLFTRRWYNISSITGGSTDSTDISRMTIVVKGDDKVVEQVVK 64 H ++VLVLNKPGVL RISGL +RR +NI SI G T+ +I+R+T+VV+GDD ++ QVVK Sbjct: 3 HSLAVLVLNKPGVLARISGLLSRRMFNIESIAAGYTEDPNITRITLVVQGDDHILYQVVK 62 Query: 65 QLNKLIEVIKVIDLDEEECVERELCLIKIYAPTESSKSQVIQYANIFRGNIVDLSQESLT 124 QL+KL++VIK+ +L + + REL LIK+ A S ++ ++ +IFR ++VD+++E++ Sbjct: 63 QLSKLVDVIKIHELAVSDSINRELALIKVRADDPSRRADIVNIVDIFRASVVDVNRETMV 122 Query: 125 VQITGDKTKISAFIKLVKPMGIKEISRTGLTALMRGPKILK 165 +++TG + KI A ++ GI E+ RTG L RGP K Sbjct: 123 IELTGTEEKIDALCGVLGEHGIVEMVRTGKICLDRGPGAAK 163 Lambda K H 0.317 0.134 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 83 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 169 Length of database: 171 Length adjustment: 18 Effective length of query: 151 Effective length of database: 153 Effective search space: 23103 Effective search space used: 23103 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_013840791.1 DESRU_RS03735 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.14717.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.14717.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.