Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate WP_013841011.1 DESRU_RS04905 KR domain-containing protein
Query= SwissProt::O08756 (261 letters) >NCBI__GCF_000215085.1:WP_013841011.1 Length = 255 Score = 82.4 bits (202), Expect = 8e-21 Identities = 68/204 (33%), Positives = 98/204 (48%), Gaps = 19/204 (9%) Query: 8 VKGLVAVVTGGASGPWLATAKRLVGQGATAVLLDVPDSEGESQAKK----LGESCIFAPA 63 +KG VA+VTG +SG + AK L QGA V + + Q KK +G CI Sbjct: 7 LKGKVALVTGASSGLGVQFAKALANQGAD-VAIAARRVDRLEQVKKEIEAMGVRCIAVFC 65 Query: 64 NVTSEKEIQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINVNLI 123 +VT ++I A + KE+FGRID+ VN AG+ I Q E++ +NL Sbjct: 66 DVTVSEQITAMVNTVKEEFGRIDILVNNAGVGKGIPAATQSD------EEWLSTTRINLD 119 Query: 124 GTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQ--AAYSASKGGIDGMTLP 181 G + VA E+G+ +Q G IIN S+ + G +AY ASKG + +T Sbjct: 120 GVY----FVAREVGKVMIEQ--NYGKIINLGSIHSMVAMAGSPISAYCASKGAVLMLTKA 173 Query: 182 IARDLAPTGIRVVTIAPGLFATPL 205 +A + A I V I P F + + Sbjct: 174 LANEWAKYNITVNAIGPAYFPSEM 197 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 255 Length adjustment: 24 Effective length of query: 237 Effective length of database: 231 Effective search space: 54747 Effective search space used: 54747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory