Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_013842297.1 DESRU_RS11590 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQI0 (292 letters) >NCBI__GCF_000215085.1:WP_013842297.1 Length = 293 Score = 358 bits (920), Expect = e-104 Identities = 180/293 (61%), Positives = 232/293 (79%), Gaps = 1/293 (0%) Query: 1 MNLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMMGAFIGYFLINSFQMN 60 M + LQQL+NG+ LGS+YAL+ALGYTMVYGI+KLINFAHGD+YM+GA++G+F + Sbjct: 1 MEVFLQQLINGISLGSIYALIALGYTMVYGIVKLINFAHGDVYMVGAYLGFFATSILGWG 60 Query: 61 FFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGVSFLLEYGMVYLVGANTRA 120 F ALI++ML AILGVVIE LAY+PLR + RIA LITAIGVS LEYG + +V R Sbjct: 61 FLPALIMSMLVCAILGVVIEKLAYKPLRGAPRIAALITAIGVSLFLEYGTMIIVSPQVRT 120 Query: 121 FPQAIQTVRYDL-GPISLTNVQLMILGISLILMILLQVIVQKTKMGKAMRAVSVDSDAAQ 179 FPQ + V + L G +++TN Q++IL +++ILM+LLQ IV KT GKAMRAVS D AA+ Sbjct: 121 FPQVLTEVHWKLFGNLTITNRQVIILAVTIILMLLLQYIVHKTMTGKAMRAVSHDQQAAR 180 Query: 180 LMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTPGLKSFVAAVLGGIGIIP 239 LMGINV+ TIS TFA+GSALA AAGVL+ +YYN++ PLMG+ PGLK+FVAAVLGGIGIIP Sbjct: 181 LMGINVDTTISATFAIGSALAAAAGVLVGIYYNAINPLMGLMPGLKAFVAAVLGGIGIIP 240 Query: 240 GAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPAGILGKNVKEKV 292 GA GGF++G++E + +G S +RD + + IL++ILIV+PAG+ GKNV+EKV Sbjct: 241 GAMTGGFLLGIVEAMVSGYGKSLYRDPVAFIILIIILIVKPAGLFGKNVREKV 293 Lambda K H 0.330 0.146 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 293 Length adjustment: 26 Effective length of query: 266 Effective length of database: 267 Effective search space: 71022 Effective search space used: 71022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory