Align acetyl-CoA C-acetyltransferase (subunit 2/2) (EC 2.3.1.9) (characterized)
to candidate WP_014026312.1 PYRFU_RS03770 thiolase family protein
Query= BRENDA::I3R3D1 (383 letters) >NCBI__GCF_000223395.1:WP_014026312.1 Length = 383 Score = 162 bits (409), Expect = 2e-44 Identities = 113/342 (33%), Positives = 173/342 (50%), Gaps = 4/342 (1%) Query: 42 EIEHLYVSNMASGEFEGQTGVPNALAHDLAAMPAYTARIDQTSSSGGAGVYAAWQSVASG 101 E E + V++ SG Q + + LA L P R++ SGGA + A+ VASG Sbjct: 42 EPEAIVVASAFSGVLGDQLVLGDHLATWLGLTPRPAFRVEAGLGSGGAALALAYGLVASG 101 Query: 102 ASDMTMLVGGEKMT-HRSTAEATDVIASLTHPVEYKHGVTLPSFAGLTARLYLDTYDAPR 160 A +LVG EK+ H + + E +G+ + + L AR Y++TY R Sbjct: 102 AYRSVLLVGVEKLADHPTWVHGWVDTLEMDSRNEGYYGMGVAAAYALMARYYMETYGVTR 161 Query: 161 ESLGKVAVKNHKNGLDNPHAQFRKEVDLETVLDSPVVADPLRLYDFCPITDGSAALVFCS 220 L V+ H+N NP+A R + E V SP++A+PL +D P++DG+A ++ Sbjct: 162 RQLSLWPVRMHENARGNPYAALRNPLTPEAVERSPLLAEPLHQFDAGPVSDGAAVVLLVG 221 Query: 221 ESVAREYTDDYVVISGIGGATDTHVVHERADPTTMGGVVNSSDIAYEMADLEPDDIDVAE 280 E V E + +V + G+ ATD + R + V ++ Y+ +L P +IDV E Sbjct: 222 EGV--EGCEKHVEVKGVEAATDYQSLGLRPAIDELRAVRIVAERLYKRFNLTPINIDVIE 279 Query: 281 LHDMFTILEFLQSEDLGFFEKGEGWKAVEEGVTDRDGELPINTSGGLKSKGHPLGASGVA 340 L D+++I L E LG EKG +A+EEG + +N SGG K++G GA+GV Sbjct: 280 LRDVYSITGLLALESLGLVEKGHAARALEEGRFGANDRPVVNPSGGTKARGEVGGATGVY 339 Query: 341 QVYEIYKQLIGDAGDRQVD-ADIGLACNVGGFGNCVTTTIME 381 Q+ E Y QLIG+ VD A L ++GG + T T++E Sbjct: 340 QIVEAYLQLIGEGVGVNVDNARRALVVDIGGPASNATATLLE 381 Lambda K H 0.315 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 383 Length adjustment: 30 Effective length of query: 353 Effective length of database: 353 Effective search space: 124609 Effective search space used: 124609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory