Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_014026963.1 PYRFU_RS07015 3-hydroxyacyl-CoA dehydrogenase
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000223395.1:WP_014026963.1 Length = 666 Score = 198 bits (503), Expect = 3e-55 Identities = 115/263 (43%), Positives = 164/263 (62%), Gaps = 5/263 (1%) Query: 1 MEFET--IETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKG 58 MEF + + + E N+ W+ LNRP+ NALN +L+ + A+ + R I++ G G Sbjct: 405 MEFASGKVVARLEENIGWVILNRPEARNALNPDMLKGIREAIETLIARGA-RAIVLMGAG 463 Query: 59 KAFCAGADITQFNQLTPAEAW-KFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALA 117 AG DI + + P +AW + S++ + +E I I+GYALGGGLELALA Sbjct: 464 GVLSAGFDIRKIAETKPQKAWLEISEEFGKTARLLEEAPAAIIVAIDGYALGGGLELALA 523 Query: 118 CDIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGL 177 DIRIA++ A LG PEINLG PG GGTQRL + +G RAL ++MTG+ I + AE++GL Sbjct: 524 ADIRIASDRATLGQPEINLGFIPGAGGTQRLVKHLGVSRALWLVMTGEMIDAETAEQWGL 583 Query: 178 VNRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFS 237 V VVP + LE E R LA+K+A+K P+++A K VV +S L +GLA E+ + + + Sbjct: 584 VADVVPASLLEFEARLLAKKLAEKPPLAIAAAKRVVRAAAESSLAAGLAAEAGMFSALLA 643 Query: 238 TEDKKEGVSAFLEKREPT-FKGK 259 +ED KEG+ AFLEKR F+G+ Sbjct: 644 SEDAKEGIRAFLEKRRAAKFRGE 666 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 666 Length adjustment: 31 Effective length of query: 228 Effective length of database: 635 Effective search space: 144780 Effective search space used: 144780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory