Align Short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_014146766.1 MEALZ_RS01260 isovaleryl-CoA dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2983 (375 letters) >NCBI__GCF_000968535.2:WP_014146766.1 Length = 358 Score = 138 bits (347), Expect = 3e-37 Identities = 98/331 (29%), Positives = 156/331 (47%), Gaps = 7/331 (2%) Query: 44 AGLGFFGMLVPEQWGGCDTGYLAYAMALEEI--AAGDGACSTIMSVHNSVGCVPILNYGT 101 AG G VP+ GG + A E++ A D ++ H P+LNYG Sbjct: 23 AGFGLLKHAVPQNRGGHGNHFADLVQAHEQLGKACQDPGLLLSINAHLWGTVFPLLNYGN 82 Query: 102 DEQKERFLKPLASGAMLGAFALTEPQAGSDASGLKTRARLEGDHYVLNGCKQFITSGQNA 161 EQ+ +L L G +G A+TEPQAGSD + L A + LNG K+FIT+ A Sbjct: 83 AEQQATYLNDLLEGKRIGGHAITEPQAGSDLTALTMTAEQTDAGFTLNGHKRFITNTPIA 142 Query: 162 GVVIVFAVTDPSAGKRGISAFIVPTDSPGYKVARVEDKLGQHASDTCQILFEDVKVPLAN 221 +++V+A +G R +SAFIV D PG G + + +D ++PL Sbjct: 143 DLLVVYA----RSGTR-LSAFIVHADDPGAAFLDTPQVSGCKNATMGDVRLDDCRIPLDR 197 Query: 222 RLGEEGEGYRIALANLEGGRVGIASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAF 281 +LG+ G G + LE R I + G+ E ++RER G + ++QA+ Sbjct: 198 QLGKTGAGNMMIQQALELERAFIFAGIRGVMERQLEGVIRFSRERRVNGAHLGKNQAIGH 257 Query: 282 RLADMATQIAVARQMVHYAAALRDSGKPALVEASMAKLFASEMAEKVCSSALQTLGGYGY 341 ++ADM T++ R V+ A L+D + + ++ KLFA+E + A G G Sbjct: 258 KIADMKTRLDTIRLWVNECARLKDRKQRITLASAQTKLFAAEAFLQSSLDAAHIFGASGL 317 Query: 342 LNDFPVERIYRDVRVCQIYEGTSDIQRMVIS 372 L +D +++ G+S+IQ+ +I+ Sbjct: 318 LEGGQQLERIQDALASRLFSGSSEIQKNIIA 348 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 358 Length adjustment: 30 Effective length of query: 345 Effective length of database: 328 Effective search space: 113160 Effective search space used: 113160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory