Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate WP_014146962.1 MEALZ_RS02230 acetyl-CoA C-acyltransferase
Query= SwissProt::O32177 (391 letters) >NCBI__GCF_000968535.2:WP_014146962.1 Length = 380 Score = 329 bits (844), Expect = 7e-95 Identities = 185/389 (47%), Positives = 243/389 (62%), Gaps = 12/389 (3%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGNIDDLIIGCATPE 60 M VI AR+P A KG LA VRPDDL A VK + + G I+DLI+GCA PE Sbjct: 1 MNNVVIAGYARSPFTPAGKGELAHVRPDDLAAQVVKALIDKCGVDPNAIEDLILGCAFPE 60 Query: 61 AEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAESM 120 EQGLN+AR + LA LP +V +TVNR+C S +Q+I AA I + A + I G ESM Sbjct: 61 GEQGLNLARLVVHLAELPISVAGMTVNRFCGSSMQAIHIAAGAIQMNAGEVFICAGVESM 120 Query: 121 SQVPMMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAKAL 180 S+VPM G T P+ L + PE YMSMG TAE +A++Y ++R DQ+ FA+ S + A Sbjct: 121 SRVPMGGFNTLPHPGLYKNHPEAYMSMGETAENLARRYSIARRDQENFALTSQRKTQHAR 180 Query: 181 AEGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSVDGTV 240 G F DEIVP+ +T G+ QD RP +TA+ L+ L+PAF +G+V Sbjct: 181 QSGGFADEIVPI---LTHRGDR---------IDQDGCPRPDSTAEGLAGLKPAFLENGSV 228 Query: 241 TAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPRALK 300 TA SS +DGAAAV++ ADA GL L + +S AV PE+MGIGPV A +AL+ Sbjct: 229 TAATSSPLTDGAAAVLVCSEAYADAHGLPKLARIKSIAVSACQPEIMGIGPVAATHKALQ 288 Query: 301 LAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL 360 AGL L+DI L ELNEAFA+QA+ V++EL I EK+N++GGAIALGHPLG TG ++T Sbjct: 289 RAGLTLEDIDLVELNEAFAAQALAVLQELPIPIEKLNLDGGAIALGHPLGATGARITGKA 348 Query: 361 IHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 + R +++ + T CIGGG G A + E Sbjct: 349 ASLLHRERKRYALATQCIGGGQGIATILE 377 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 380 Length adjustment: 30 Effective length of query: 361 Effective length of database: 350 Effective search space: 126350 Effective search space used: 126350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_014146962.1 MEALZ_RS02230 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.9622.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-134 434.8 0.7 1.7e-134 434.5 0.7 1.0 1 lcl|NCBI__GCF_000968535.2:WP_014146962.1 MEALZ_RS02230 acetyl-CoA C-acylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000968535.2:WP_014146962.1 MEALZ_RS02230 acetyl-CoA C-acyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.5 0.7 1.7e-134 1.7e-134 1 385 [] 6 377 .. 6 377 .. 0.98 Alignments for each domain: == domain 1 score: 434.5 bits; conditional E-value: 1.7e-134 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaala 67 i +++R+p++ + +g l++++++dL+a+v+k+l+++ g+dp++i+++ilG+++++geq n+aR ++ lcl|NCBI__GCF_000968535.2:WP_014146962.1 6 IAGYARSPFTpAGKGELAHVRPDDLAAQVVKALIDKCGVDPNAIEDLILGCAFPEGEQgLNLARLVVHL 74 67899*****9779******************************************************* PP TIGR01930 68 aglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakl 136 a+lp sv+++tvnr+C+S++qA+++aa +i++ + +v++ +GvEsmSrvp++ + ++g +k+ lcl|NCBI__GCF_000968535.2:WP_014146962.1 75 AELPISVAGMTVNRFCGSSMQAIHIAAGAIQMNAGEVFICAGVESMSRVPMGGFNT----LPHPGLYKN 139 ***************************************************88875....789999999 PP TIGR01930 137 edqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgkkkvv 205 + ++ +smgetAenla++y+i R++q+++al S++k+++A ++g f+deivp+ ++ + + lcl|NCBI__GCF_000968535.2:WP_014146962.1 140 HP-------EAYMSMGETAENLARRYSIARRDQENFALTSQRKTQHARQSGGFADEIVPILTHR-GDRI 200 99.......8899**********************************************97776.7999 PP TIGR01930 206 skDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaav 274 ++D ++rp++t+e La+Lkpaf e +gs vtA+ ss+l+DGAaa+l+ se+ a+++gl lari s+av lcl|NCBI__GCF_000968535.2:WP_014146962.1 201 DQDGCPRPDSTAEGLAGLKPAFLE-NGS-VTAATSSPLTDGAAAVLVCSEAYADAHGLPKLARIKSIAV 267 **********************96.9*7.**************************************** PP TIGR01930 275 agvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGH 343 ++++pe+mg+gpv A++kaL++agl+++didlvE+nEAFAaq+lav +el + ek+N GGAiAlGH lcl|NCBI__GCF_000968535.2:WP_014146962.1 268 SACQPEIMGIGPVAATHKALQRAGLTLEDIDLVELNEAFAAQALAVLQELP-IPIEKLNLDGGAIALGH 335 ***************************************************.88*************** PP TIGR01930 344 PlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 PlGa+Gari+ + ++ L++++k+y+lat C+ggGqG+A+ile lcl|NCBI__GCF_000968535.2:WP_014146962.1 336 PLGATGARITGKAASLLHRERKRYALATQCIGGGQGIATILE 377 ****************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.19 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory