Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_014449006.1 LFE_RS04105 3-isopropylmalate dehydratase small subunit
Query= curated2:A1K4A2 (212 letters) >NCBI__GCF_000284315.1:WP_014449006.1 Length = 208 Score = 239 bits (611), Expect = 2e-68 Identities = 116/211 (54%), Positives = 151/211 (71%), Gaps = 8/211 (3%) Query: 1 MKPFTVLDAIVAPLDRANVDTDAIIPKQFLKSIKRSGFGPNLFDEWRYLDVGQPGQDCSN 60 M+ F L +IV P+DRANVDTDAIIPKQFLK+I R+G G +LF +WRYL G Sbjct: 1 MEAFKTLKSIVIPIDRANVDTDAIIPKQFLKTIHRTGLGKSLFYDWRYLSDGVT------ 54 Query: 61 RPKNPDFVLNQARYQGAQVLLARDNFGCGSSREHAPWALEDYGFRVIIAPSFADIFFNNS 120 NPDFV+NQ RY+G ++LL+R+NFG GSSREHAPWAL D+G + IIAPSFADIF+NN Sbjct: 55 --PNPDFVINQTRYKGGRILLSRENFGSGSSREHAPWALLDFGIKAIIAPSFADIFYNNC 112 Query: 121 FKNGLLPIKLDAAELDVLFQQCEATEGYRLKVDLAAQTITRPDGKAIAFDVDPFRKECLL 180 FKNG+LPI++D +D LF++ + T GY+ +++L +Q I PDG+ I F++D F K+CLL Sbjct: 113 FKNGILPIRIDRMIVDGLFKEIDRTPGYQAEINLESQLILLPDGRTIPFEIDAFLKKCLL 172 Query: 181 NGWDDIGLTLRHADKIRDFEAKRRAEHPYYF 211 G DDI LT I +E +RR E P+ F Sbjct: 173 EGLDDISLTFEKKALITSYEDRRRKEAPWLF 203 Lambda K H 0.323 0.141 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 208 Length adjustment: 21 Effective length of query: 191 Effective length of database: 187 Effective search space: 35717 Effective search space used: 35717 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 45 (21.9 bits)
Align candidate WP_014449006.1 LFE_RS04105 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.25054.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.25054.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.