Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_014449569.1 LFE_RS07230 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00010 (365 letters) >NCBI__GCF_000284315.1:WP_014449569.1 Length = 231 Score = 114 bits (284), Expect = 3e-30 Identities = 73/223 (32%), Positives = 116/223 (52%), Gaps = 15/223 (6%) Query: 4 LKIENLKKGF----EGLSIIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGT 59 ++ ENL K + + L ++K I++++ FV G SG GKSTLL L+ ++ T G Sbjct: 7 IRCENLSKSYMMGKKELPVLKEINIDLPAGVFVALTGASGAGKSTLLHLVGTIDRPTMGR 66 Query: 60 IELDGRDITEVTP------AKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPD---- 109 + RD++E++ R + VFQ + L P T +N+ +AG+ + Sbjct: 67 VIHGDRDVSELSEYDLASFRNRHIGFVFQFHHLLPEFTALENVLMPSWIAGKSLMEEVGV 126 Query: 110 VERKVAEAARILELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALR 169 +E + E + L L KP +LSGG++QRVAI RA+V NP I L DEP NLD Sbjct: 127 IENRARELLDRVGLSGRLSHKPSELSGGEQQRVAIARALVMNPSILLADEPTGNLDTHTS 186 Query: 170 VQTRLELSRLHKELQATMIYVTHDQVEAMTLATKVVVLNAGRI 212 + L ++ E T+I TH++ A A +++++ GRI Sbjct: 187 FEVFDLLRTVNHEQGITLIMATHNEALA-ERADRIIIMEDGRI 228 Lambda K H 0.319 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 231 Length adjustment: 26 Effective length of query: 339 Effective length of database: 205 Effective search space: 69495 Effective search space used: 69495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory