Align Glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate WP_014450204.1 LFE_RS10505 aldehyde dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_495 (480 letters) >NCBI__GCF_000284315.1:WP_014450204.1 Length = 492 Score = 189 bits (480), Expect = 2e-52 Identities = 142/473 (30%), Positives = 219/473 (46%), Gaps = 32/473 (6%) Query: 19 WVDADNGQTIKVNNPATGEILGTV---PKMGAAETRRAIEAA----DKALPAWRALTAKE 71 W ++GQ + P T I G P A R+ I+ A A+T Sbjct: 18 WGKWESGQKQETGVPFTEMIPGPEGRNPWQYALGDRKTIDLVLSGLSNASRVMGAMTRHR 77 Query: 72 RATKLRRWYELIIENQDDLARLMTLEQGKPLAEAKGEIVYAASFIEWFAEEAKRIYGDVI 131 R+ L L+ N++ LA L+ E GKP++ A+ E+ AA+ + A +I Sbjct: 78 RSLILSETARLLDVNREALANLLVCEVGKPISAARFEVERAATTFLLASRLATDFGSQLI 137 Query: 132 PGHQPDKRL----IVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPF 187 PG + +V + PIG AITP+NFP ++ K PALA+GC +V+KPA + Sbjct: 138 PGDIVPQGARMTGMVERVPIGPVLAITPYNFPLNLLAHKVAPALASGCPVVVKPAPKGAL 197 Query: 188 SAFALAELAQRAGIPAGVFSVVSGSAGDIGSELTSNPIVRKLSFTGSTEIGRQLMSECAK 247 SA AL ++ AG+P S+V ++ + P + +SFTGS E+G L + Sbjct: 198 SALALGKILLSAGLPPEALSIVPCDIPEV-LLMVDAPEIPVISFTGSAEVGWSLRDRVPR 256 Query: 248 DIKKVSLELGGNAPFIVFDDADLDKAVEGAIISKYRNNGQTCVCANRLYIQDGVYDAFAE 307 K+V LELGGNA ++ DA + V+ + + +GQ C+ R+ + YD F E Sbjct: 257 --KQVLLELGGNAAVVILKDAIEEGLVDRLMTGAFAYSGQICISIQRILVDRSRYDRFLE 314 Query: 308 KLKVAVAKL----KIGNGLEAGTTTGPLIDEKAVAKVQEHIADALSKGATVLAGGKPMEG 363 V K+ IG+ + T G LI E +V E + A+S+GA K + G Sbjct: 315 TFVERVRKMGNEGGIGDPASSSTLMGSLISETHATRVHEKVLSAISRGAVSSLPVKRL-G 373 Query: 364 NFFEPTILTNVPNNAAVAKEETFGPLAPLFRFKDEADVIAMSNDTEFGLASYFYARDLGR 423 P IL+ + + +EE FGP+ + F A+ + N + FG+ + L Sbjct: 374 AMLHPVILSGTDADDPIEQEEVFGPVVTVNPFDSPAEAVKRVNGSRFGIQASIMTGSLET 433 Query: 424 VFRVAEALEYGMVGVNTGLISNEVA-------PFGGIKASGLGREGSKYGIED 469 +A LE G G++ NE+ P+GG+K SG G EG Y +E+ Sbjct: 434 GILMAGELEMG------GVLVNEIPTFRLDHWPYGGVKESGKGWEGVAYAMEE 480 Lambda K H 0.317 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 25 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 480 Length of database: 492 Length adjustment: 34 Effective length of query: 446 Effective length of database: 458 Effective search space: 204268 Effective search space used: 204268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory