Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_015738329.1 ADEG_RS01445 3-oxoacyl-ACP reductase FabG
Query= metacyc::MONOMER-16231 (254 letters) >NCBI__GCF_000024605.1:WP_015738329.1 Length = 253 Score = 159 bits (401), Expect = 7e-44 Identities = 92/247 (37%), Positives = 136/247 (55%), Gaps = 2/247 (0%) Query: 2 KLLEGKTVLVTGASTGIGRAAAIGAAQHGADVAINYAHSDGPAQSCVAEIEALGQRAIAV 61 + LEGK LVTGAS GIG A A+ AQ GA VA+N+ S A+ G +A A Sbjct: 5 RFLEGKVALVTGASRGIGAAVALALAQSGAAVAVNFCRSAAQAEEVARRCREWGVKAQAF 64 Query: 62 KGDVADPQTAQDFVAKAVETFGKVDVMVSNAGICPFHAFLDMPVDVVERTFKVNLHGAYF 121 + DV DP+ + A G V ++V+NAG+ +D + E+ +VNL G ++ Sbjct: 65 RADVTDPEEVRRLFAAVSAELGPVSILVNNAGMGLRRLLVDTSDEEWEKLLRVNLSGPFY 124 Query: 122 MVQAAAQQMVRQGHGGSIVAVSSISALVGGEYQTHYTPTKAGVHSLMQSTAIALGKHGIR 181 + A M+RQ G I+ ++S+ + G + Y TK G+ +L +S A +G GI Sbjct: 125 CCREALPFMIRQ-RWGRIINIASVWGITGASCEAAYAATKGGLIALTKSLAREVGSAGIT 183 Query: 182 CNSVLPGTILTEINKDDLADQEKREYMEARTPLGRLGAPEDLAGPIVFLASDMAAYVTGA 241 N++ PG I T++ +++LA +E EA P GRLG PE++A VFLAS AA++ G Sbjct: 184 VNALAPGPIETDLLREELAPEELAALAEA-IPSGRLGRPEEVAAACVFLASPAAAFINGQ 242 Query: 242 ALLVDGG 248 L +DGG Sbjct: 243 VLGLDGG 249 Lambda K H 0.318 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory