Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_015739104.1 ADEG_RS05575 3-isopropylmalate dehydratase small subunit
Query= BRENDA::Q58673 (168 letters) >NCBI__GCF_000024605.1:WP_015739104.1 Length = 166 Score = 157 bits (398), Expect = 6e-44 Identities = 81/159 (50%), Positives = 113/159 (71%), Gaps = 3/159 (1%) Query: 5 IKGRVWKFGNNVDTDAILPARYLVYTKP-EELAQFVMTGADPDFPKKVKPGDIIVGGKNF 63 ++GR KFG++++TD I+ +Y T EELA+ VM DP+F K++PGD IV G NF Sbjct: 1 MRGRAHKFGDDINTDYIISGKYKFKTLDMEELARHVMEDLDPEFYHKIRPGDFIVAGWNF 60 Query: 64 GCGSSREHAPLGLKGAGISCVIAESFARIFYRNAINVGLPLIECKGISEKVNEGDELEVN 123 GCGSSRE APL +K A I V+A+SFARIF+RNAIN GLP++EC ++++ GDELEV+ Sbjct: 61 GCGSSREQAPLVIKHARIGAVLAKSFARIFFRNAINTGLPVVECD--TDQIEAGDELEVD 118 Query: 124 LETGEIKNLTTGEVLKGQKLPEFMMEILEAGGLMPYLKK 162 L G ++NLT G + + LP M++ILE GGL+ + +K Sbjct: 119 LARGVVENLTKGISIPIKPLPPVMLKILEDGGLIAHFQK 157 Lambda K H 0.317 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 166 Length adjustment: 18 Effective length of query: 150 Effective length of database: 148 Effective search space: 22200 Effective search space used: 22200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_015739104.1 ADEG_RS05575 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR02087 (3-isopropylmalate dehydratase, small subunit)
../bin/blast/fastacmd -i /tmp/list.18714.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.18714.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.