Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_015739397.1 ADEG_RS07165 aspartate aminotransferase family protein
Query= reanno::Koxy:BWI76_RS11670 (406 letters) >NCBI__GCF_000024605.1:WP_015739397.1 Length = 460 Score = 221 bits (564), Expect = 3e-62 Identities = 145/390 (37%), Positives = 206/390 (52%), Gaps = 39/390 (10%) Query: 26 VRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWHTGNGYTNEPVL- 84 V+ EG++LWD++GK Y DF G +GH HP+++ AL G + T T P+ Sbjct: 44 VKAEGAKLWDEEGKMYWDFLGSFGAMNIGHNHPKVLAALDLVRG--FPTMVQTTLSPLAG 101 Query: 85 RLAKQL--IDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVAFKNAFHGRT 142 LA+ L + R FFCNSGAEA E ALKLAR + + G + N+FHG+T Sbjct: 102 ALARNLCRLAPGGMKRAFFCNSGAEAVEGALKLARA------ATGRPGFIYCHNSFHGKT 155 Query: 143 LFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAK-ALIDDNTCAVIVEPMQGEGGVVPA 201 +S G+ Y + F PL P Q Y+DL + + AL A IVEP+QGEGG++ Sbjct: 156 FGALSVTGRKKYQEPFLPLLPNCQAIPYDDLAALEEALHKKEAAAFIVEPIQGEGGIIVP 215 Query: 202 DADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLSTAKALGGG-FPI 260 +LR + LC + LLI DE+QTG+GRTG+L+A H GV PD++ AK+LGGG PI Sbjct: 216 SPGYLREAKRLCSRYGTLLIVDEIQTGLGRTGKLFACEHDGVEPDIICLAKSLGGGVIPI 275 Query: 261 GALLASERC-----ASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNGVKQRHQWF 315 GA L ++ S H +T+GGN ACA A I ++ ++ ++F Sbjct: 276 GAFLTTDAIWNKAYGSPDRAQLHTSTFGGNAWACAAALATLEVILEEDLPRQAARKGEFF 335 Query: 316 CERLNAINARY-GLFKEIRGLGLLIGCVLKDEYAGKAKAIS----NQAAEEGLMILIAG- 369 RL + ARY L KE+RG GLL+G ++ G ++ ++ AEE L L+AG Sbjct: 336 LARLRELQARYPHLIKEVRGKGLLVGVEFAEKQKGVLSRLTFGWVDRLAEEFLGSLVAGQ 395 Query: 370 ---------------ANVVRFAPALIISED 384 NV+R P L++ E+ Sbjct: 396 LLNRFRILTAYTLNNPNVIRLEPPLVVEEE 425 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 35 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 460 Length adjustment: 32 Effective length of query: 374 Effective length of database: 428 Effective search space: 160072 Effective search space used: 160072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory