Align 3-ketoacyl-CoA thiolase B, peroxisomal; Acetyl-CoA acyltransferase B; Beta-ketothiolase B; Peroxisomal 3-oxoacyl-CoA thiolase B; EC 2.3.1.155; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_015797735.1 AFER_RS01350 acetyl-CoA C-acyltransferase
Query= SwissProt::P07871 (424 letters) >NCBI__GCF_000023265.1:WP_015797735.1 Length = 390 Score = 294 bits (752), Expect = 4e-84 Identities = 175/395 (44%), Positives = 249/395 (63%), Gaps = 17/395 (4%) Query: 34 SASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVK-LKPECLGDISVGNVL 92 +A + V+V RTPIGRA +G D PD+L V+ +L V L P + D+ G + Sbjct: 2 TAREAVIVATARTPIGRAFKGSLVDVRPDDLSGLVIAELLTRVPALDPASVDDVIWGAAI 61 Query: 93 QPGAGAA-MARIAQFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVE 151 Q G + + R L+G+PETVP + VNR C+S LQA+ I D +A GVE Sbjct: 62 QHGEQSMNLGRNVAALAGLPETVPGTTVNRFCASSLQAIRMAFHAIMADEGDAFIAGGVE 121 Query: 152 SMT-LSERG-NPGNISSRLLENEKA---RDCLIPMGITSENVAERFGISRQKQDAFALAS 206 S T S +G +P +++ R + +A IPMG+T+ENVA+R+G++R+ DA+A+ S Sbjct: 122 STTRASIKGFDPEDMNPRFTDESRADFVNHMYIPMGLTAENVADRYGVTREAMDAYAVIS 181 Query: 207 QQKAASAQSKGCFRAEIVPVTTTVLDDKGDRKTITVSQDEGVRPSTTMEGLAKLKPAFKD 266 Q++A +AQ +G F AE + VTT G+ V +D+G RP+TT+E LA LKPAF+ Sbjct: 182 QERAVAAQERGFFDAETIAVTTP----SGN----VVRRDDGPRPNTTLEVLATLKPAFRP 233 Query: 267 GGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIP 326 G TAGNS ++DGAA V++ RS+AE LG+ L + + AV G+ P+IMG+GP A+ Sbjct: 234 DGRVTAGNSCPLNDGAAGVIVMERSRAEALGIRPLAKIVASAVTGIAPEIMGVGPIDAVR 293 Query: 327 AALQKAGLTVNDIDIFEINEAFASQALYCVEKLGIPAE-KVNPLGGAIALGHPLGCTGAR 385 A L++AGLT+ DID+ E+NEAFA+Q L V++ GI + ++NP GGAIALGHP G TGAR Sbjct: 294 AVLERAGLTIGDIDVVELNEAFAAQVLPVVKETGISIDHQLNPNGGAIALGHPFGMTGAR 353 Query: 386 QVVTLLNELKRRGRRAYGVVSMCIGTGMGAAAVFE 420 + TLL+EL G R G+ +MC+G G G A + E Sbjct: 354 IMTTLLHELDELGAR-LGLETMCVGGGQGMAMIVE 387 Lambda K H 0.316 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 390 Length adjustment: 31 Effective length of query: 393 Effective length of database: 359 Effective search space: 141087 Effective search space used: 141087 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory