Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_015797971.1 AFER_RS02590 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_000023265.1:WP_015797971.1 Length = 265 Score = 128 bits (321), Expect = 1e-34 Identities = 82/254 (32%), Positives = 129/254 (50%), Gaps = 21/254 (8%) Query: 10 PLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKI 69 P+L V+ V + V + G +F V G + +IGPNGAGKST+ I G L P G I Sbjct: 6 PILVVDGVVRAF-GGVHAVDGCSFTVADGSITGLIGPNGAGKSTMVNLIAGALRPDAGTI 64 Query: 70 TFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENL------EMGAFIRNDSLQPLK 123 F G +I GL +++ LG+ QI+ +P+++V ENL ++G + P + Sbjct: 65 NFDGHDITGLAPHKVAELGLIRTFQISREYPAMTVMENLMVSPLRQVGEGLMTALFAPRR 124 Query: 124 DK------------IFAMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPS 171 + I A F L R + AG+LSGG++++L + +A+M EP +L+LDEP Sbjct: 125 YRQQELELVARARGILAAF-GLEHMRDEYAGSLSGGQKRLLELARAVMAEPKMLILDEPM 183 Query: 172 AALSPILVTQVFEQVKQINQE-GTAIILVEQNARKALEMADRGYVLESGRDAISGPGQEL 230 A ++P LV ++ E + +I G ++VE N + D V+ +G +G EL Sbjct: 184 AGINPALVDRICEHINEIRSSLGVTFLIVEHNLDVVERITDHVVVMAAGCALATGTMAEL 243 Query: 231 LTDPKVAELYLGAG 244 + V YL G Sbjct: 244 RENEAVVNAYLTGG 257 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 265 Length adjustment: 24 Effective length of query: 223 Effective length of database: 241 Effective search space: 53743 Effective search space used: 53743 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory