Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_015798154.1 AFER_RS03680 KR domain-containing protein
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000023265.1:WP_015798154.1 Length = 252 Score = 257 bits (657), Expect = 1e-73 Identities = 139/254 (54%), Positives = 178/254 (70%), Gaps = 5/254 (1%) Query: 8 VKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTS 67 ++G V+TGGASGLGL AERL+G+GA V++D G A A +L + F ADVT Sbjct: 3 LRGSSVVVTGGASGLGLGVAERLIGRGAHVVIVDRNAEAGAAVAARL--SAEFVEADVTD 60 Query: 68 EKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFN 127 E+ + A A G V + V CAGI +A + + G+ H L FQRV+ VNL+GTFN Sbjct: 61 EEQLARAFDRAAA-LGPVRMGVACAGIGIAERVLG-RSGEPHQLASFQRVIGVNLIGTFN 118 Query: 128 VIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLA 187 ++RL A +G +EP G +RGVI+ TAS+AAF+GQ+GQ AY+ASKGG+VGMTLP ARDLA Sbjct: 119 LLRLAARAIGASEPADG-ERGVIVLTASIAAFDGQIGQIAYAASKGGVVGMTLPAARDLA 177 Query: 188 PIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLN 247 IRV+TIAPG+ TPLL LPE+V L + +PFP RLG PA++A LV+AI EN +LN Sbjct: 178 SAQIRVVTIAPGIMDTPLLGQLPEEVRRDLGASIPFPKRLGQPADFAQLVEAIAENHYLN 237 Query: 248 GEVIRLDGAIRMQP 261 GEVIRLDGA+RM P Sbjct: 238 GEVIRLDGALRMPP 251 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 252 Length adjustment: 24 Effective length of query: 237 Effective length of database: 228 Effective search space: 54036 Effective search space used: 54036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory